|
|
|
|
|
|||||||||||||
|
ARTIGOS PUBLICADOS EM PERIÓDICOS |
|
|
P001-05 Faecal shield of the tortoise beetle Plagiometriona aff. flavescens (Chrysomelidae: Cassidinae) as chemically mediated defence against predators Nogueira-de-Sá F, Trigo JR* Larvae of Plagiometriona aff. flavescens carry a structure on their back made of faeces and exuviae, called a faecal shield, which may protect larvae against natural enemies. Previous investigations suggested that the nature of such protection was chemical. To test if chemicals found in the faecal shield of Plagiometriona aff. flavescens provided defence for larvae, experiments in the field and in the laboratory (using the ant Camponotus crassus, and chicks Gallus gallus as model predators) were undertaken. Both field and laboratory experiments showed that live larvae with faecal shields as well as baits treated with faecal shield extracts, were rejected by predators, confirming the chemical nature of this kind of defence. Journal of Tropical Biology 21: 189-194, 2005. *E-mail: trigo@unicamp.br
P002-05 Sesquiterpene and polyacetylene profile of the Bidens pilosa complex (Asteraceae: Heliantheae) from Southeast of Brazil Grombone-Guaratini MT, Silva-Brandão KL, Solferini VN, Semir J, Trigo JR* The pantropical weed Bidens pilosa (Asteraceae) is a species with several taxonomic problems. Recently it has been shown to be a complex of different species. To shed light on this problem in Brazil, dicloromethane extract of leaves of several populations corresponding to three proposed species for the complex in southeastern Brazil (B. pilosa, B. alba and B. subalternans) were analyzed by GC-MS. Twenty-four substances were detected, of which four resemble polyacetylenes, the others sesquiterpenes. Five sesquiterpenes tentatively identified as E-caryophyllene, a-humulene, germacrene D, bicyclogermacrene and a-muurolene were found in all three Bidens species. Polyacetylene phenylhepta-1,3,5-triyne was identified only in B. alba. Cluster and principal component analyses separated the three entities, suggesting that these compounds could represent a useful tool to distinguish species in the B. pilosa complex. Biochemical Systematics and Ecology 35: 479-486, 2005. IF = 0.827 *E-mail: trigo@unicamp.br
P003-05 Host-plant flowering status and the concentration of sugar in phloem sap: Effects on an ant-treehopper interaction Quental TB, Trigo JR, Oliveira PS* Host-plant mediation in ant-hemipteran mutualisms requires three conditions: 1) hemipteran attractiveness to ants should vary with plant quality; 2) ants should preferentially tend those Hemiptera that produce the most nutritious attractant; 3) increased ant attendance based on a richer food reward should have a significant effect on some measure of hemipteran fitness. This is the first study to simultaneously test these conditions, and the first to test the effect of plant flowering status on the ant-derived benefits for a honeydew-producing hemipteran. It is hypothesized that membracids (Guayaquila xiphias) feeding on plants (Didymopanax vinosum) with flowers ingest phloem sap of higher sugar concentration, produce a higher-quality honeydew, are attended by more ants and are better protected compared to those on plants without flowers. The results of this suggest that a trade-off between feeding on a higher-quality food and running increased risk of predation on flowering plants could underlie this ant-hemipteran interaction. Based on the parameters measured in this study it is concluded that host-plant mediation does not occur in the ant-Guayaquila system. The results suggest, however, that the way in which the host-plant could affect ant-Guayaquila interactions is complex and likely to involve other species. European Journal of Entomology 102: 201–208, 2005. IF = 0.745 *E-mail: pso@unicamp.br
P004-05 Similarity of cuticular lipids between caterpillar and its host plants: a way to make prey undetectable for predatory ants? Portugal AHA, Trigo JR* Ithomiine butterflies (Nymphalidae) have long-lived, aposematic, chemically protected adults. However, little is known about the defense mechanisms in larvae and other juvenile stages. We showed that larvae of the ithomiine butterfly Mechanitis polymnia are defended from ants by a chemical similarity between their cuticular lipids and those of the host plant, Solanum tabacifolium. This is a novel defense mechanism in phytophagous insects. A field survey during one season showed that larval survivorship was up to 80%, which is high when compared with other juvenile stages. In a laboratory bioassay, live larvae on their host plant were not attacked by the predatory ant Camponotus crassus (Formicidae). Two experiments showed that the similarity between the cuticular lipids of M. polymnia and S. tabacifolium hid the larvae from C. crassus: (a) when the caterpillar was switched from a host plant to a non-host plant, the predation rate increased, and (b) when a palatable larva (Spodoptera frugiperda) was coated with the cuticular lipids of M. polymnia and placed on S. tabacifolium leaves, it no longer experienced a high predation rate. This defensive mechanism can be defined as chemical camouflage. This protection may have a double adaptive advantage, namely, protection against predation and a reduction in the cost of sequestering toxic compounds from the host plant. Journal of Chemical Ecology 31: 2551-2561, 2005. IF = 2.031 *E-mail: trigo@unicamp.br
P005-05 Immature stages of Napeogenes sulphurina Bates, 1862 (Lepidoptera, Nymphalidae, Ithomiinae) from Northeastern Brazil Freitas AVL*, Brown Jr KS São descritos os estágios imaturos de Napeogenes sulphurina da região Nordeste do Brasil, e sua morfologia e posição sistemática são discutidas. Journal of the Lepidopterists’ Society 59: 35-37, 2005. *E-mail: baku@unicamp.br
P006-05 Conservation of terrestrial invertebrates and their habitats in Brazil Lewinsohn TM, Freitas AVL*, Prado PI Por ser um dos principais países megadiversos do mundo, o Brasil abriga um número imenso de invertebrados terrestres. O conhecimento atual desta biota é extremamente heterogêneo. Diversos taxa são suficientemente conhecidos para serem utilizados como indicadores de integridade ecológica ou de endemismo. As atuais listas vermelhas nacionais e regionais brasileiras incluem 130 espécies de invertebrados terrestres, dos quais 42% são borboletas. Tais listas são bastante dependentes do conhecimento disponível e muitos taxons omitidos certamente incluem espécies ameaçadas. O conhecimento de diversos biomas e hábitats é bastante irregular. Há necessidade de mais estudos sobre a Caatinga e o Pantanal em comparação à Mata Atlântica, à Amazônia e ao Cerrado. As faunas de solo, de dossel e associadas a hospedeiros também necessitam de estudos intensivos. A conservação de invertebrados será promovida mais eficientemente através da preservação e do manejo de hábitats do que através de iniciativas de preservação de espécies isoladas. Para esse fim, são necessários melhores estudos geográficos de taxocenoses ou grupos funcionais completos. Uma melhor compreensão do papel dos invertebrados em processos ecossistêmicos fortalecerá enormemente os argumentos para sua conservação. Conservation Biology 19: 640-645, 2005. IF = 4.110 Megadiversidade 1: 62-69, 2005 *E-mail: baku@unicamp.br
P007-05 Biological traits of frugivorous butterflies in a fragmented and a continuous landscape in the South Brazilian Atlantic Forest Uehara-Prado M, Freitas AVL*, Brown Jr KS We tested whether five biological traits of frugivorous butterflies of the Brazilian Atlantic Forest differ between a continuous forest and an adjoining fragmented landscape. Possible fragmentation effects were detected in sex ratio and age structure, but we found no evidence that recapture rates, wing size, or damage in frugivorous butterflies were related to forest fragmentation. We suggest that 1) landscape is sufficiently permeable and suitable for maintaining most general biological patterns in butterflies, 2) non-effects might be statistical artifacts, 3) the traits examined are usually not affected by this level of fragmentation, or 4) the most abundant frugivorous butterflies demonstrate some resistance to habitat fragmentation. Journal of the Lepidopterists’ Society 59: 96-106, 2005. *E-mail: baku@unicamp.br
P008-05 Rediscovery of Actinote zikani (D’Almeida) (Nymphalidae, Heliconiinae, Acraeini): Natural history, population biology and conservation of an endangered butterfly in SE Brazil Francini RB, Freitas AVL*, Brown Jr KS Actinote zikani (D'Almeida) (Nymphalidae, Heliconiinae, Acraeini) was rediscovered in 1991 in Paranapiacaba, São Paulo, 40 years after its original description (based on specimens from the Boracéia Ecological Station, Salesópolis, São Paulo); 49 years after its last collection, and studied during three years. The adults go through two yearly generations, one in March (earlier than the other species of Actinote in the region) and the other in November (bivoltinism). The mean residence of the adults is less than one week, and the sex ratio in the field is male biased. The only known host plant for the species is Mikania obsoleta (Asteraceae), and the immature stages are similar to those known for other species of Actinote. The range of A. zikani is within one of the most densely human populated regions in Brazil, making urgent the creation of effective preserved areas where colonies of this species are known. Journal of the Lepidopterists’ Society 59: 134-142, 2005 *E-mail: baku@unicamp.br
P009-05 Phylogenetic relationships of the New World Troidini swallowtails (Lepidoptera: Papilionidae) based on COI, COII, and EF-1 genes Silva-Brandão KL, Freitas AVL*, Brower AVZ, Solferini VN A phylogeny of the Neotropical members of the Tribe Troidini (Lepidoptera: Papilionidae) was obtained with sequences of three protein-coding genes: two mitochondrial (COI and COII) and one nuclear (EF-1). Parsimony and Bayesian analyses of 33 taxa resulted in very similar trees regardless of method used, with the 27 troidines always forming a monophyletic clade. Character optimization of ecological and morphological traits over the phylogeny proposed for troidines indicated that the use of several species of Aristolochia is ancestral over the use of few or a single host-plant. For the other three characters, the ancestral states were the absence of long tails, forest as the primary habitat and oviposition solitary or in loose group of several eggs. Molecular Phylogenetics and Evolution 36: 468-483, 2005. IF = 3.431 *E-mail: baku@unicamp.br
P010-05 Chromatin supraorganization, DNA fragmentation, and cell death in snake erythrocytes Miyamoto M, Vidal BC, Mello MLS*Chromatin supraorganization, DNA fragmentation and cell death were investigated in four snake species (Crotalus durissus terrificus, Bothroups jararaca, B. alternatus, and B. neuwiedii), which differ in their geographical distribution and habitats, by using image analysis of Feulgen hydrolysis kinetics, the TUNEL assay, single-cell gel electrophoresis, and transmission electron microscopy. The differences found in the erythrocyte biology of the mentioned snakes are assumed to be related to selected hemoglobin variants, and that could lead the cells to different resistances to unfavorable environmental conditions. Biochemistry and Cell Biology 83: 15-27, 2005. (capa de revista) IF = 2.870 *E-mail: mlsmello@unicamp.br
P011-05 Chromatin supraorganization and extensibility in mouse hepatocytes following starvation and refeeding Moraes AS, Vidal BC, Guaraldo AMA, Mello MLS*The effect of 48 h of starvation and of 48 h of refeeding following starvation on chromatin supraorganization and extensibility (formation of extended chromatin fibers) was studied in hepatocytes from adult mice, using topochemical tests, image analysis, gravity action, and polarization microscopy. The results indicated loss, regain, and redistribution of nuclear proteins (nuclear matrix) related to chromatin organization and extensibility depending on the nutritional state of the organism. Cytometry Part A 63: 94-107, 2005. IF = 2.115 *E-mail: mlsmello@unicamp.br
P012-05 Nucleus image properties and cell death in MCF-10F cells grown on slide substrates differing in nature and size Mello MLS*, Lareef MH, Santos AB, Russo J, Vidal BC Since many relevant data have thus far been raised for MCF-10F cells grown on glass slides, the effect of the nature of the slides and of the surface size of the slide chambers available for cell growth were studied. The slide substrate type and the chamber size were found to affect the cells’ nuclear image and apoptotic ratios. Plastic slides with a growth size of 9.4 cm2 were found to be more advantageous for growing MCF-10F cells. In Vitro Cellular & Developmental Biology-Animal 41: 92-96, 2005. IF = 0.718 *E-mail: mlsmello@unicamp.br
P013-05 Extended chromatin fibers in mouse testicular spermatozoa Moraes AS, Mello MLS* Drastic changes in basic nuclear proteins also affecting chromatin organization occur in mouse sperm cells in comparison to somatic cells. It was thus assumed that formation of extended chromatin fibers (ECF) after treatment of mouse spermatozoa with lysis solutions under the action of gravity could differ from that previously reported for mouse liver cells. The frequency of ECF formation for the spermatozoa was found to be much higher (60%) than that for hepatocytes under same experimental conditions (22%) despite the extremely compact DNA-protein complex structure present in the sperm cells of the mouse. This was attributed to extraction of protamines from the DNA-protein complexes in the spermatozoa facilitated by the lysis protocol. Brazilian Journal of morphological Sciences 22: 91-96, 2005 *E-mail: mlsmello@unicamp.br
P014-05 Apoptosis in polyploid cells of the blood-sucking hemipteran, Triatoma infestans Klug Mello MLS* The Feulgen-DNA content of differently polyploid nuclei in Malpighian tubule cells of T. infestans engaged into apoptotic processes was evaluated. The objective was to ascertain whether a relation existed between apoptosis and specific ploidy degrees attained with progress in development or elicited by stress. All nuclei with different ploidy degrees were demonstrated as susceptible to apoptosis. The giant nuclei generated by in response to stress were found not equally efficient against stressful conditions. Caryologia 58: 281-287, 2005. IF = 0.295 *E-mail: mlsmello@unicamp.br
P015-05 Supramolecular order following binding of the dichroic birefringent sulfonic dye Ponceau SS to collagen fibers Vidal BC*, Mello MLS Optical anisotropies such as linear dichroism and birefringence were studied in chicken tendon collagen fibers stained with the sulfonic azo-dye Ponceau SS and also in crystalline aggregates of this dye in order to assess the polarizing properties and similarity to liquid crystals of the collagen-dye complexes obtained. Biopolymers 78: 121-128, 2005. IF = 2.545 *E-mail: camposvi@unicamp.br
P016-05 Eye pigments of the blood-sucking insect, Triatoma infestans Klug (Hemiptera, Reduviidae) Moraes AS, Pimentel ER, Rodrigues VLCC, Mello MLS* The pigments of black (wild) and red (mutant) eyes of T. infestans were analysed spectrophotometrically by ascending paper chromatography, and compared with red-eyed (wild) and white-eyed (mutant) forms of D. melanogaster. The eye color difference in T. infestans was attributed to concentration of xanthommatin (which probably does not affect the insect’s visual acuity), and not to differences in pigment types. Brazilian Journal of Biology 65: 477-481, 2005. *E-mail: mlsmello@unicamp.br
P017-05 Extracellular matrix of ostrich articular cartilageTomiosso TC, Gomes L, Vidal BC, Pimentel ER*The articular cartilage of the proximal and distal regions of the tarsometatarsus were investigated. Structural analysis showed that the fibrils were arranged in different directions, especially on the distal region. The protein and GAG contents of this region were greater than in the other regions. SDS-PAGE showed the presence of proteins with Mr ranging from 17 to 121 kDa and polydisperse components of 67, 80-100, and 250-300 kDa in both regions. The analysis of GAGs revealed the presence of only chondroitin-sulfate. Unlike other cartilages, the small proteoglycan decorin contained chondroitin-sufate and not dermatan-sulfate. The higher amounts of proteins and GAGs and the multidirectional arrangement of fibrils seen in the distal region may be correlated with the higher compression normally exerted on that region. Biocell 29: 47-54, 2005. IF = 0.585 *E-mail: pimentel@unicamp.br
P018-05 Conservation of marine and coastal biodiversity in Brazil Amaral ACZ*, Jablonsky S The invertebrate benthos, most especially the micro- and meso-faunal components, of the Brazilian seas is still poorly known. Considerably fewer species have been recorded, reflecting the lack of research in this field. The intertidal zone, to depths of about 20 m, has been studied the most, and there the numbers of endemic species are relatively high. The diversity of demersal and pelagic fishes is similar among the major marine regions, and endemism is typically low and restricted to reef species. Overexploitation, both for food and by the aquarium fish trade, habitat degradation and destruction, the introduction of alien species, pernicious tourism, and pollution, are the principal threats to Brazil’s marine biodiversity. The Ministry of the Environment has published a list of 36 benthic species which are threatened, along with a further 10 which are at risk of being overexploited. Fishes officially listed as threatened include 15 species of sharks and rays, and 7 teleosts. A further 6 elasmobranchs and 27 teleosts are currently or potentially overexploited. The conservation of marine biodiversity in Brazil is still broadly inadequate despite the existing legislation and several protected areas. The number and size of marine protected areas are insufficient, and a number of those existing still lack management plans or have yet to receive the appropriate measures and infrastructure to make them effective. The fisheries administration and management is still precarious, and in many areas lacks the effective participation of the communities involved. Here we provide a review of our understanding of the diversity of the invertebrate benthos and marine fishes of Brazil, and of the species recognized as threatened, and the principal initiatives underway for their conservation. Conservation Biology 19: 625-631, 2005. IF = 4.110 Megadiversidade 1: 43051, 2005. *E-mail: ceamaral@unicamp.br
P019-05 Morphometric analyses of two species of Scolelepis (Polychaeta: Spionidae) Maccord FS, Amaral ACZ* Seven hundred and six specimens of Scolelepis cf. chilensis and 551 specimens of Scolelepis goodbodyi were classified according to sex (male, female, and immature individuals). Width (w) and height (h) of setigers 3 and 5, the position of the first and the last gametogenic setigers, the total number of setigers, and the total length of each worm were measured. The area and volume of the setigers were estimated. Discriminant analysis was used to determine whether there were sexually dimorphic features, apart from the presence of gametes. Linear regression analysis was used to evaluate the relationship between each parameter and the number of setigers. Scolelepis cf. chilensis was found to be significantly larger than S. goodbodyi (t test). These species also differed in the position of the first gametogenic setiger. There were no sexually dimorphic features in either sex of S. cf. chilensis or S. goodbodyi. The total length showed the strongest correlation with the number of setigers in both species, followed by the width and the volume of setigers. Journal of the Marine Biological Association of the United Kingdom 85: 829-834, 2005. IF = 0.745 *E-mail: ceamaral@unicamp.br
P020-05 Along and across-shore components of the spatial distribution of the clam Tivela mactroides (Born, 1778) (Bivalvia, Venereidae) Denadai MR, Amaral ACZ*, Turra A Beach clam fisheries often provide an alternate income for traditional fishermen, but this activity is highly vulnerable to urbanization of coastal areas. Tivela mactroides is a beach clam commonly harvested in the Caribbean (Venezuela) and on the south-eastern Brazilian coast. Only localized records on its spatial structure in size and abundance are available to support management of this clam The present study showed that the spatial distribution in abundance and size of T. mactroides in Caraguatatuba Bay, state of São Paulo, Brazil, has both along- and across-shore (intertidal and subtidal) components. The nature of this distribution should be taken into account in the design of further population or monitoring studies concerning this species. The intertidal and subtidal across-shore distribution of clam abundance and size varied between and within areas (southern and northern). The uppermost limit of their distribution was 0.8 m (southern) and 0.4m (northern), and an upwards tendency towards increased size was more evident in the northern area. In the subtidal, abundance and individual size tended to increase from the deepest (4.5 m) to the shallowest (0.5 m) levels only in the southern area. The species had an ontogenic distribution: small-sized individuals were recorded only in the subtidal. Possible causes for these findings (human exploitation, organic pollution, beach morphodynamics, differential recruitment, and adult-larvae interactions) are discussed, and specific studies are suggested to evaluate formally the proposed hypotheses. Journal of Natural History 39: 3275-3295, 2005. IF = 0.694 *E-mail: ceamaral@unicamp.br
P021-05 Characterization of the insulinotropic action of a phospholipase A(2) isolated from Crotalus durissus collilineatus rattlesnake venom on rat pancreatic islets Nogueira TC, Ferreira F, Toyama MH, Stoppiglia LF, Marangoni S*, Boschero AC, Carneiro EM The ability of PLA2 and crotapotin, isolated from Crotalus durissus collilineatus rattlesnake venom, to stimulate insulin secretion from isolated rat islets was studied. PLA2 and crotapotin stimulated insulin secretion at 2.8 mmol/L glucose, whereas at a high glucose concentrations (16.7 mmol/L) only PLA2 stimulated secretion. Nifedipine (10 micromol/L) did not alter the ability of PLA2 to increase insulin secretion stimulated by a depolarizing concentration of K+ (30 mmol/L). PLA2 did not affect 14CO2 production but significantly increased the efflux of arachidonic acid from isolated islets. These results indicate that PLA2-stimulated secretion is not dependent on an additional influx of Ca2+ through L-type Ca(2+)-channels but rather is associated with arachidonic acid formation in pancreatic islets Toxicon 45:243-248, 2005. IF = 2.255 *E-mail: marango@unicamp.br
P022-05 Determination of amino acid Sequence of a new PLA2 isolated from Micrurus dumeralii carinicauda venom Belo CA, Toyama MH, Toyama DO, Marangoni S, Cavada BS, Fontana MD, Hyslop S, Carneiro EM, Boschero AC* We have isolated a new phospholipase A2 (MiDCA1) from the venom of the coral snake Micrurus dumerilii carinicauda. The toxin has a molecular mass of 15,552Da, and shares high sequence homology with the PLA2 toxins MICNI A and B from Micrurus nigrocinctus venom. In chick biventer cervicis preparations, MiDCA1 produced concentration- and time-dependent neuromuscular blockade that reached 100% after 120 min (2.4 microM, n = 6); contractures to exogenously applied carbachol (8 microM) and KCl (13 mM) were still seen after complete blockade. In mouse phrenic-nerve diaphragm preparations, MiDCA1 caused triphasic changes followed by partial neuromuscular blockade. Intracellular recordings of end-plate potentials and miniature end-plate potentials (MEPPs) from mouse diaphragm preparations showed that MiDCA1 increased the quantal content by 386+/-12% after 10 min (n = 14) and caused a triphasic change in the frequency of MEPPs. MiDCA1 also decreased the resting membrane potential, an effect that was prevented by tetrodotoxin and/or low extracellular calcium, but not by d-tubocurarine. These results show that MiDCA1 is a new presynaptic phospholipase A2 that produces neuromuscular blockade in vertebrate nerve-muscle preparations. Journal of Protein Chemistry 24:147-153, 2005. IF = 1.487 *E-mail: boschero@unicamp.br
P023-05 Biochemical, Pharmacological and Structural Characterization of a New PLA(2) from Crotalus durissus terrificus (South American Rattlesnake) Hernandez-Oliveira S, Toyama MH, Toyama DO, Marangoni S*, Hyslop S, Rodrigues-Simioni L. A new PLA2 (F16) was purified from Crotalus durissus terrificus venom by molecular exclusion chromatography followed by analytical reverse phase HPLC. The PLA2 (14.86 kDa by MALDI-TOF mass spectrometry) had an amino acid sequence of SLLQFNKMIKFETRKNAVPFYAFYGCYCGWGRRRPKDATDRCCFVHDCCYEKVTKCNTKWDIYRYSLKSGYITCGKGTWCKEQICECDRVAECLRRSLSTYKNGYMFYPDSRCRGPSETC, and showed highly conserved Ca2+-binding and catalytic sites. F16 (10 microg/ml) produced neuromuscular blockade in chick biventer cervicis preparations in the absence and presence of crotapotin, indicating that crotapotin was not essential for neuromuscular action in this preparation. On the other hand, in mouse phrenic nerve-diaphragm preparations, the neuromuscular blockade produced by the same concentration of toxin was dependent on crotapotin. Pre-incubation with heparin markedly reduced the neurotoxicity of F16. These results show that the biochemical and structural properties of F16 are similar to those of the PLA2 isoforms F15 and F17, but that the neurotoxicity and the requirement for crotapotin to form the crotoxin complex varies according to the neuromuscular preparation. Protein Journal 24: 233-242, 2005. IF = 1.200 *E-mail: marango@unicamp.br
P024-05 Biochemical and enzymatic characterization of two basic Asp(49) phospholipase A(2) isoforms from Lachesis muta muta (Surucucu) venom Damico DCS, Lilla S, de Nucci G, Ponce-Soto LA, Winck FV, Novello JC, Marangoni S* Two basic phospholipase A2 (PLA2) isoforms were isolated from Lachesis muta muta snake venom and partially characterized. From liquid chromatography-electrospray ionization/mass spectrometry, the molecular mass of the two isoforms LmTX-I and LmTX-II was respectively measured as 14,245.4 and 14,186.2 Da. The pI was respectively estimated to be 8.7 and 8.6 for LmTX-I and LmTX-II.. The two proteins were sequenced and differentiated from each other by a single amino acid substitution, Arg65 (LmTX-I)-->Pro65 (LmTX-II). Full PLA2 activity required Ca2+ and was respectively inhibited by Cu2+ and Zn2+ in the presence and absence of Ca2+. Crotapotin from Crotalus durissus cascavella rattlesnake venom significantly inhibited the enzymatic activity of LmTX-I, suggesting that the binding site for crotapotin in this PLA2 was similar to another in the basic PLA2 of the crotoxin complex from C. durissus cascavella venom Biochimica et Biophysica Acta-General Subjects 1726: 75-86, 2005. IF = 2.418 *E-mail: marango@unicamp.br
P025-05 A multivariate study on the inhibition of the xanthine oxidase by phenylpyrazole compounds da Silva SL, Marangoni S*, Weber KC, Honório KM, Homem–de–Mello P, da Silva ABF A set of phenylpyrazole compounds was studied in order to determine the molecular properties responsible for their previously tested ability to inhibit the xanthine oxidase (XO) enzyme. The chemometric methods PCA, HCA and SDA were employed to find the subset of variables that could correctly classify the compounds according to their inhibitory activity. The PCA, HCA and SDA results showed that four variables can be considered as relevant for the XO inhibitory activity: μ (dipole moment), QR2 (total charge of the substituent R2), D3 (torsion angle formed by the atoms C6-C1-C2-R2) and MR (molar refractivity). From the PCA, HCA and SDA results, a reliable classification model was built, as the cross-validation error is equal to 0%. This indicates that this model can be used in the search for new phenylpyrazole compounds that present XO inhibitory activity. Internet Electronic Journal of Molecular Design 4: 515–526, 2005. *E-mail: marango@unicamp.br
P026-05 Neurotoxic and myotoxic actions from Lachesis muta muta (surucucu) whole venom on the mouse and chick nerve-muscle preparations Damico DC, Bueno LG, Rodrigues-Simioni L, Marangoni S, Cruz-Hofling MA, Novello JC* Lachesis genus is one of the less studied among others from Viperidae's genera, mainly due to difficulties in obtaining the venom. Accidents by Lachesis snakes cause severe envenoming syndrome, eventually leading victims to shock. This work is part of a comprehensive study aimed at studying the venom and its effects. Herein the neurotoxicity and myotoxicity of L. muta muta venom were investigated on mouse phrenic nerve-diaphragm (PNDp) and chick biventer cervicis (BCp) preparations. In BCp, a venom dose of 50 microg/ml significantly reduced contractures elicited by exogenous acetylcholine (55 microM) and KCl (20 mM), as well as increased the release of creatine kinase (442.7+/-39.8 IU/l in controls vs 4322.6+/-395.2 IU/l, after 120 min of venom incubation. Quantification of myonecrosis in BCp indicated the doses 50 and 10 microg/ml as significantly myotoxic affecting 59.7+/-6.2%, and 20.8+/-1.2% of fibers, respectively, whereas 5 and 2 microg/ml that affected 13.5+/-0.8% and 5.4+/-0.6% of fibers, were considered weakly- and non-myotoxic, respectively. We concluded that there are neurotoxins present in the venom, the concentration of which governs its pre- (if low) or postsynaptic (if high) activity. Since myotoxicity in the avian preparation is negligible at lower venom doses, but not neurotoxicity, we suggest that this effect may contribute minimum to the venom neurotoxic effect. Toxicon 46: 222-229, 2005. IF = 2.255 *E-mail: jcn@unicamp.br
P027-05 Cross-neutralization of the neurotoxicity of Crotalus durissus terrificus and Bothrops jararacussu venoms by antisera against crotoxin and phospholipase A2 from Crotalus durissus cascavella venom Beghini,DG, Cruz-Hofling MA, Randazzo-Mourac P, Rodrigues-Simioni L, Novello JC, Hyslop S, Marangoni S* Rabbit antisera raised against crotoxin from C. d. cascavella venom (cdc-crotoxin) and its PLA2 were examined in its ability to neutralize the neurotoxicity of C. d. terrificus and B. jararacussu venoms and of their main toxins, cdt-crotoxin and Bothropstoxin (BthTX-I), respectively, in mouse nerve phrenic-hemidiaphragm preparations. Immunobloting and Elisa assays indicated cross-reactivity between the crotoxin of both rattlesnakes species and between the cdc-PLA2 and BthTX-I. Commercial equine antisera against C. d. terrificus venom antagonized the neurotoxicity produced by the bothropic venom and its major toxin. The results suggest that commercial equine antiserum enriched with anti-PLA2s antibodies may be more effective to neutralize envenoming effects caused by crotalic and bothropic accidents. Toxicon 46: 604-611, 2005. IF = 2.255 *E-mail: marango@unicamp.br
P Dal Belo CA, Leite GB, Toyama MH, Marangoni S*, Corrado AP, Fontana MD, Southan A, Rowan EG, Hyslop S, Rodrigues-Simioni L A new Phospholipase A(2) (PLA(2)) from Micrurus dumerilii carinicauda venom was isolated and its primary structure determined. This new PLA(2) showed a low enzymatic activity when compared with other PLA(2)s and it is moderately basic with a pI of 8.0. Its amino acid sequence showed the presence of 120 amino acid residues and its sequence was: NLIQFLNMIQCTTPGREPLVAFANYGCYCGRGGSGTPVDELDRCCQVHDNCYDTAKKVFGCSPYFTMYSYDCSEGKLTCKDNNTKCKAAVCNCDRTAALCFAKAPYNDKNYKIDLTKRCQ. The structural model of MIDCA1, when compared with other strong neurotoxic PLA(2)s, such as Naja naja, showed significant differences in the beta-wing and neurotoxic sites, despite the high level of amino acid sequence similarity. These observations indicate a dissociation between the biological and catalytic activity of this new PLA(2), supporting the view that other regions of the protein are involved in the biological effects. Toxicon 46: 736-750, 2005. IF = 2.255 *E-mail: marango@unicamp.br
P029-05 Effects of morin on snake venom phospholipase A(2) (PLA(2)) Iglesias CV, Aparicio R, Rodrigues-Simioni L, Camargo EA, Antunes E, Marangoni S*, Toyama D O, Beriam LO, Serra Azul Monteiro H, Toyama MH Flavonoids are potent anti-inflammatory compounds isolated from several plant extracts, and have been used experimentally against inflammatory processes. In this work, a PLA2 isolated from the Crotalus durissus cascavella venom and rat paw oedema were used as a model to study the effect of flavonoids on PLA2. We observed that a treatment of PLA2 with morin induces several modifications in the aromatic amino acids, with accompanying changes in its amino acid composition. Circular dichroism spectroscopy and UV scanning data revealed important structural modifications. Concomitantly, a considerable decrease in the enzymatic and antibacterial activities was observed, even though anti-inflammatory and neurotoxic activities were not affected. These apparent controversial results may be an indication that PLA2 possess a second pharmacological site which does not affect or depend on the enzymatic activity. Toxicon 46:751-758, 2005. IF = 2.255 *E-mail: marango@unicamp.br
P030-05 A new C-type animal lectin isolated from Bothrops pirajai is responsible for the snake venom major effects in the isolated kidney Havt A, Toyama MH, Do Nascimento NR, Toyama DO, Nobre AC, Martins AM, Barbosa PS, Novello JC, Boschero AC*, Carneiro EM, Fonteles MC, Monteiro HS We investigated the biochemical and biological effects of a new C-type galactoside specific lectin termed BPL that was isolated from the snake venom of Bothrops pirajai. The purified BPL was homogeneous by reverse phase HPLC and SDS-PAGE. We evaluated the nephrotoxicity of the whole venom of B. pirajai and its lectin. The whole venom of B. pirajai showed similar results as those observed for BPL evaluated by the perfused rat kidney method. They caused reductions in perfusion pressure, renal vascular resistance, urinary flow, glomerular filtration rate and sodium, potassium and chloride tubular transport. Neither whole venom nor purified BPL induced direct vasoactive effects in perfused arteriolar mesenteric bed, and BPL did not potentiate bradykinin contraction in the ileum. We postulate that B. pirajai and BPL promoted the same renal effects probably caused by release of inflammatory mediators. International Journal of Biochemistry & Cell Biology 37:130-141, 2005. IF = 3.871 *E-mail: boschero@unicamp.br
P031-05 Effects of diabetes and CETP expression on diet-induced atherosclerosis in LDL receptor-deficient mice Berti JA, Salerno AG, Bighetti EJB, Casquero AC, Boschero AC, Oliveira HCF The role of CETP expression and diabetes in atherogenesis was investigated in mice with heterozygous disruption of the LDL receptor gene (LDLR1). LDLR1 mice with and without CETP expression were treated with streptozotocin (STZ) and maintained on a standard diet for one month before switching to an atherogenic diet for an additional month. STZ-sensitive mice had approximately 2.5-fold higher glycemia and 7.5- to 8.0-fold higher cholesterolemia. CETP expression in non-diabetic mice resulted in a 50% reduction in the area of the atherosclerotic lesions. Multiple regression analysis showed a positive and independent atherogenic effect of triglyceridemia in LDLR1 mice and of cholesterolemia in diabetic mice. Elevated plasma cholesterol level significantly increased the risk of developing large lesion size. In conclusion, CETP expression did not alter the lesion formation in response to diabetes, although it may be protective in the euglycemic state; the triglyceride level was an independent risk factor for LDL receptor-deficient mice but not for CETP-expressing mice; and elevated plasma cholesterol levels increased the risk of developing large atherosclerotic lesions, independently of CETP and diabetes. APMIS 113: 37-44, 2005. IF = 2.127 *E-mail: boschero@unicamp.br
P032-05 Short-term in vivo inhibition of IRS-1 expression leads to insulin resistance, hyperinsulinemia and increased adiposity Araújo EP, De Souza CT, Gasparetti AL, Ueno M, Boschero AC*, Saad MJA, Velloso LA Insulin receptor substrate-1 (IRS-1) has an important role as an early intermediary between the insulin and IGF receptors and downstream molecules that participate in insulin and IGF-I signal transduction. Here we employed an antisense oligonucleotide (IRS-1AS) to inhibit whole-body expression of IRS-1 in vivo and evaluate the consequences of short-term inhibition of IRS-1 in Wistar rats. Four days of treatment with IRS-1AS reduced the expression of IRS-1 by 80, 75, and 65% in liver, skeletal muscle, and adipose tissue, respectively. This was accompanied by a 40% reduction in the constant of glucose decay during an insulin tolerance test, a 78% reduction in glucose consumption during a hyperinsulinemic-euglycemic clamp, and a 90% increase in basal plasma insulin level. The metabolic effects produced by IRS-1AS were accompanied by a significant reduction in insulin-induced [Ser (473)] Akt phosphorylation in liver, skeletal muscle, and adipose tissue and a significant reduction in insulin-induced tyrosine phosphorylation of ERK in liver and skeletal muscle. However, insulin-induced tyrosine phosphorylation of ERK was significantly increased in adipose tissue of IRS-1AS-treated rats. In rats treated with IRS-1AS for 8 d, a 100% increase in relative epididymal fat weight and a 120% increase in nuclear expression of peroxisome proliferator-activated receptor-gamma were observed. Thus, acute inhibition of IRS-1 expression in rats leads to insulin resistance accompanied by activation of a growth-related pathway exclusively in white adipose tissue. Endocrinology 146:1428-1437, 2005. IF = 5.313 *E-mail: boschero@unicamp.br
P033-05 Western diet modulates insulin signaling, JNK activity and IRS-1ser307 phosphorylation in a tissue-specific fashion Prada PO, Zechin HG, Gasparetti AL, Torsoni MA, Ueno M, Hirata AE, Corezola do Amaral ME, Hoer NF, Boschero AC*, Saad MJA The mechanisms by which diet-induced obesity is associated with insulin resistance are not well established, and no study has until now integrated, in a temporal manner, functional insulin action data with insulin signaling in key insulin-sensitive tissues, including the hypothalamus. In this study, we evaluated the regulation of insulin sensitivity by hyperinsulinemic-euglycemic clamp procedures and insulin signaling, c-jun N-terminal kinase (JNK) activation and insulin receptor substrate (IRS)-1(ser307) phosphorylation in liver, muscle, adipose tissue, and hypothalamus, by immunoprecipitation and immunoblotting, in rats fed on a Western diet (WD) or control diet for 10 or 30 d. WD increased visceral adiposity, serum triacylglycerol, and insulin levels and reduced whole-body glucose use. After 10 d of WD (WD10) there was a decrease in IRS-1/phosphatidylinositol 3-kinase/protein kinase B pathway in hypothalamus and muscle, associated with an attenuation of the anorexigenic effect of insulin in the former and reduced glucose transport in the latter. In WD10, there was an increased glucose transport in adipose tissue in parallel to increased insulin signaling in this tissue. After 30 d of WD, insulin was less effective in suppressing hepatic glucose production, and this was associated with a decrease in insulin signaling in the liver. In summary, the insulin resistance induced by WD is tissue specific and installs first in hypothalamus and muscle and later in liver, accompanied by activation of JNK and IRS-1(ser307) phosphorylation. The impairment of the insulin signaling in these tissues, but not in adipose tissue, may lead to increased adiposity and insulin resistance in the WD rats. Endocrinology 146:1576-1587, 2005. IF = 5.313 *E-mail: boschero@unicamp.br
P034-05 Co-expression and regulation of connexins 36 and 43 in culutred neonatal pancreatic islets Leite AR, Furtado AG, Boschero AC*, Collares-Buzato CB Fetal and neonatal pancreatic islets present a lower insulin secretory response as compared with adult islets. We investigated the effect of culturing neonatal islet cells for varying periods of time and with different glucose medium concentrations on the cellular expression of the endocrine pancreatic gap junction associated connexin (Cx) 36 and Cx43. The 7-d culture induced upregulation of the expression of these junctional proteins in neonatal islets in a time-dependent manner. Increasing glucose concentration within the culture medium induced a concentration-dependent enhancement of Cx36 islet expression, but not of Cx43 expression in cultured neonatal islets. In conclusion, we suggest that the regulation of gap junctional proteins by culture medium containing factors and glucose may be an important event for the maturation process of beta cells observed at in vitro conditions. Canadian Journal of Physiology and Pharmacology 83:142-151, 2005. IF = 1.522 *E-mail: boschero@unicamp.br
P035-05 Structure-function relationship of new crotamine isoforma from the Crotalus durissus cascavella Toyama DO, Boschero AC*, Martins AM, Fonteles CM, Monteiro SH, Toyama HM We isolated a novel crotamine like protein from the Crotalus durissus cascavella venom by combination of molecular exclusion and analytical reverse phase HPLC. Its primary structure was:YKRCHKKGGHCFPKEKICLPPSSDLGKMDCRWKRK-CCKKGS GK. This protein showed a molecular mass of 4892.89 Da that was determined by Matrix Assisted Laser Desorption Ionization Time-of-flight (MALDI-TOF) mass spectrometry. The approximately pI value of this protein was 9.9. This crotamine-like protein isolated here (Cro 2) produced skeletal muscle spasm and spastic paralysis in mice similarly to other crotamines like proteins. Cro 2 did not modify the insulin secretion at low glucose concentration (2.8 and 5.6 mM), but at high glucose concentration (16.7 mM) we observed an insulin secretion increasing of 2.7-3.0-fold than to control. The Na+ channel antagonist tetrodoxin decreased glucose and Cro 2-induced insulin secretion. These results suggested that Na+ channel are involved in the insulin secretion. We also purified some peptide fragment from the treatment of reduced and carboxymethylated Cro 2 with cyanogen bromide and protease V8 from Staphylococcus aureus. The isolated pancreatic beta-cells were then treated with peptides only at high glucose concentration (16.7 mM), in this condition only two peptides induced insulin secretion. The consensus region of the biologically-active crotamine responsible for insulin secretion was KGGHCFPKE and DCRWKWKCCKKGSG. Protein Journal 24: 9-19, 2005. IF = 1.200 *E-mail: boschero@unicamp.br
P036-05 Biological and structural characterization of a new PLA2 from the Crotalus durissus collilineatus venom Toyama MH, Toyama DO, Joazeiro PP, Carneiro EM, Beriam LOS, Marangoni S, Boschero AC* The biological characterization and amino acid sequence of a new basic Phospholipase A2 (PLA2) isolated from the Crotalus durissus collilineatus venom (Cdcolli F6), which showed 122 amino acid residues with a pI value of 8.3, molecular mass of 14 kDa and an amino acid sequence identity of 80% with crotalic PLA2s such as Mojave B, Cdt F15, and CROATOX was described here. This homology, however, dropped to 50% if compared to other sources of PLA2s such as from the Bothrops snake venom. Also, this PLA2 induced myonecrosis, although this effect was lower than that of BthTx-I or whole crotoxin and it was able to induce a strong blockage effect on the chick biventer neuromuscular preparation, independently of the presence of the acid subunid (crotapotin). The p-BPB did not reduce significantly the myotoxic activity induced by the PLA2, but the anhydrous acetic acid treatment and the pre-incubation of PLA2 with heparin reduced significantly its effects. Our findings here allow to speculate that basic amino acid residues on the C-terminal and molecular regions near catalytic site regions such as Calcium binding loop or beta-wing region may be involved in the binding of PLA2 to the molecular receptor to induce the neurotoxic effect. Protein Journal 24: 103-112, 2005. IF = 1.200 *E-mail: boschero@unicamp.br
P037-05 Low protein diet reduce PKAa expression in islets from pregnant rats fed a low protein diet Milanski M, Arantes VC, Ferreira F, Barros Reis MA, Carneiro EM, Boschero AC*, Collares-Buzato CB, Latorraca MQ We investigated the effect of protein restriction on insulin secretion and the expression of protein kinase (PK)Aalpha and PKCalpha in islets from control and pregnant rats. Adult control nonpregnant (CN) and control pregnant (CP) rats were fed a normal-protein diet (17%), whereas low-protein nonpregnant (LPN) and low-protein pregnant (LPP) rats were fed a low-protein diet (6%) for 15 d. In the presence of 2.8 and 8.3 mmol glucose/L, insulin secretion by islets of CP rats was higher than that by islets of CN rats. Compared with the CN groups, insulin secretion by islets of LPN rats was lower with 8.3 but not with 2.8 mmol glucose/L. The insulin secretion by islets of LPP rats was higher than by LPN rats at both glucose concentrations. IBMX increased insulin secretion by islets from pregnant rats, and this effect was greater in islets of CP rats than in LPP rats. Forskolin increased insulin secretion only in islets of CN and CP rats, with a higher 50% effective concentration in islets of CP rats compared with CN rats. The insulin secretion induced by phorbol 12-myristate 13-acetate was higher in islets of LPN and LPP rats than in the respective controls. PKAalpha, but not PKCalpha, expression was lower in islets of rats fed low protein than in the controls. All endocrine cells of the islets, expressed the PKAalpha isoform. The cytoplasmic distribution of this enzyme in beta-cells was not modified by pregnancy and/or protein restriction. Our results indicate that the response of islets from rats fed low protein during pregnancy is similar to that of control rats, at least for physiologic glucose concentration. The decreased response to IBMX and forskolin indicates decreased production and/or sensitivity to cAMP; this was associated with a decrease in PKA expression, which may result in lower PKA activity. Journal of Nutrition 135:1873-1878, 2005. IF = 3.689 *E-mail: boschero@unicamp.br
P038-05 Short-term inhibition of peroxisome proliferator-activated receptor-gamma coactivator-1 expression reverses diet-induced diabetes mellitus and hepatic steatosis in mice De Souza CT, Araújo EP, Saad MJA, Boschero AC*, Velloso LA The coactivator of nuclear receptors, peroxisome proliferator-activated receptor-gamma coactivator-1alpha (PGC-1alpha) has been implicated in a series of events that contribute to the control of glucose metabolism. We have recently reported the use of a PGC-1alpha antisense oligonucleotide (PGC-1alphaAS) that inhibits up to 60% of PGC-1alpha expression in pancreatic islets, leading to increased insulin secretion. This oligonucleotide was used in this study to try to ameliorate diet-induced type 2 diabetes in a genetically predisposed mouse strain. Glucose and insulin tolerance tests, euglycaemic-hyperinsulinaemic clamp, immunoprecipitation assays, immunoblotting assays and immunohistochemistry were used. Swiss mice became obese and overtly diabetic after 8 weeks of feeding with chow containing 24% saturated fat. One daily dose (1.0 nmol) of PGC-1alphaAS significantly reduced glucose and increased insulin blood levels without affecting food intake and body weight. These effects were accompanied by a reduced area under the glucose curve during an intraperitoneal glucose tolerance test, an increased constant of glucose decay (K(itt)) during an insulin tolerance test, and an increased glucose consumption rate during a euglycaemic-hyperinsulinaemic clamp. Moreover, mice treated with PGC-1alphaAS presented an outstanding reduction of macroscopic and microscopic features of hepatic steatosis. PGC-1alpha is an attractive target for pharmacological therapeutics in type 2 diabetes mellitus and diet-induced hepatic steatosis. Diabetologia 48: 1860-1871, 2005. IF = 5.337 *E-mail: boschero@unicamp.br
P039-05 INGAP-related pentadecapeptide: its modulatory effect upon insulin secretion Borelli MI, Stoppiglia LF, Rezende LF, Flores LE, Del Zotto H, Boschero AC*, Gagliardino JJ We examined the effects of a pentadecapeptide having the 104-118 aminoacid sequence of islet neogenesis-associated protein (INGAP-PP) on insulin secretion, and the morphological characteristics of adult and neonatal pancreatic rat islets cultured in RPMI and 10 mM glucose for 4 days, with or without different INGAP-PP concentrations. Cultured neonatal and adult islets released insulin in response to glucose (2.8-16.7 mM) in a dose-dependent manner, and to leucine and arginine (10 mM). In all cases, the response was greater in adult islets. INGAP-PP added to the culture medium significantly enhanced glucose- and aminoacid-induced insulin release in both adult and newborn rats; however, no changes were observed with a scrambled peptide. Similar results were obtained incubating freshly isolated adult rat islets with INGAP-PP. Whereas INGAP-PP did not induce significant changes in islet survival rate or proportion/number of islet cells, it increased significantly beta-cell size. This first demonstration of the enhancing effect of INGAP-PP on the beta-cell secretory response of adult and newborn islets suggests a new way to study its production mechanism and potential use to increase the secretory capacity of endogenous islets in intact animals or of islets preserved for future transplants. Regulatory Peptides 131: 97-102, 2005. IF = 2.272 *E-mail: boschero@unicamp.br
P040-05 Insulin secretion by rat lacrimal glands: effects of systemic and local variables Cunha DA, Carneiro EM, Alves MC, Boschero AC*, Saad MJA, Velloso LA, Rocha EM To understand the secretory mechanisms and physiological role of insulin in the tear film, we examined 1) the time course of insulin secretion in the tear film under glucose intravenous stimulation, 2) the glucose- and carbachol-induced insulin secretion from isolated lacrimal gland (LG), 3) the effect of insulin on glucose consumption by the cornea, and 4) the expression of insulin, pancreatic duodenal homeobox-1 (PDX-1), and glucose transport proteins (GLUTs) in LG tissue. The findings reported here suggest that insulin secretion in the tear film is influenced by local stimuli such as nutrient and neural inputs and that this hormone plays a metabolic role in ocular surface tissues. These data also indicate that under normal conditions the insulin secreted by LG is stored, but it is not clear that is locally produced in the LG. American Journal of Physiology-Endocrinology Metabolism 289: E768-E775, 2005. IF = 4.456 *E-mail: boschero@unicamp.br
P041-05 Consumption of a fat-rich diet activates a proinflammatory response and induces insulin resistance in the hypothalamus De Souza CT, Araújo EP, Bordin S, Ashimine R, Zollner RL, Boschero AC*, Saad MJA, Velloso LA Obesity has reached epidemic proportions in several regions of the world. General changes in lifestyle, including consumption of fat-rich food, are among the most important factors leading to an unprecedented increase in the prevalence of this disease. Here we show by macroarray analysis, that high-fat feeding [hyperlipidic diet (HL)] induces the expression of several proinflammatory cytokines and inflammatory responsive proteins in hypothalamus, accompanied by increased activation of c-Jun N-terminal kinase and nuclear factor-kappaB. In addition, HL feeding leads to impaired functional and molecular activation of the insulin-signaling pathway, in parallel with increased serine phosphorylation of the insulin receptor and insulin receptor substrate-2. Intracerebroventricular treatment of HL rats with a specific inhibitor of c-Jun N-terminal kinase (SP600125) restores insulin signaling and leads to a reduced caloric intake and weight loss. In conclusion, HL feeding induces a local proinflammatory status in the hypothalamus, which results in impaired anorexigenic insulin signaling. Endocrinology 146: 4192-4199, 2005. IF = 5.313 *E-mail: boschero@unicamp.br
P042-05 Nuclear factor-kappaB and advanced glycation end-products expression in lacrimal glands of aging rats Alves M, Cunha DA, Calegari VC, Saad MJA, Boschero AC*, Velloso LA, Rocha EM Advanced glycation end products (AGEs) increase with aging and induce signaling alterations that lead to inflammation and dysfunction in several tissues. Aging reduces function and insulin signaling in lacrimal glands (LGs). To evaluate whether AGE signaling and insulin secretion in LGs are altered in aging, 24- and 2-month-old male Wistar rats were compared. Immunohistochemistry with confocal microscopy was used to evaluate AGE, AGE receptor (RAGE) and nuclear factor-kappaB (NF-kappaB) expression in LGs. Basal tear secretion volume, insulin, interleukin-1beta (IL-1beta) and tumor necrosis factor-alpha (TNF-alpha) levels in tears and LGs and peroxidase activity in LG tissue were measured. The higher expression of AGEs, RAGE and NF-kappaB in LGs of aging rats is accompanied by systemic insulin resistance and may be involved in LG and tear film alterations but does not affect insulin secretion in the tear film. These observations indicate that metabolic events may be related to LG and tear film dysfunctions in aging. Journal of Endocrinology 187:159-166, 2005. IF = 3.059 *E-mail: boschero@unicamp.br P043-05 Naturally supraorganized collagen increases axonal regeneration after tubulization repair Oliveira ALR*, Vidal BC, Langone F We assessed the importance of the molecular organization and aggregational state of collagen type I in axonal regeneration and guidance. Adult male Wistar rats were divided into four groups. In the first group, the polyethylene tube was filled with bovine collagen, while in the second, the prosthesis was filled with rat-derived collagen. In the third group, the tube was left empty, and the fourth group, consisted of unoperated rats. Six weeks after tubulization, the number of axons was significantly higher with bovine collagen than with rat collagen, as was the degree of implant absorption. These results suggest that the use of extracellular matrix substances that self-assembly in an organized pattern can enhance nerve regeneration. Brazilian Journal of morphological Sciences 22: 105-111, 2005. *E-mail: alroliv@unicamp.br
P044-05 Differential scanning calorimetry and optical properties of collagen-dichroic azo Ponceau SS complexes Vidal BC*, Volpe PLO Brazilian Journal of morphological Sciences 22: 149-153, 2005. *E-mail: mlsmello@unicamp.br
P045-05 Aerenchyma formation and recovery from hypoxia of the flooded root of system of nodulated soybean Thomas AL, Guerreiro SMC, Sodek L*Aerenchyma formation in nodulated soybean was characterized during waterlogging of the root system. Its formation in the taproot, lateral roots, adventitious roots, and submerged stem where lysogenous aerenchyma arose in the cortex and was gradually replaced by secondary aerenchyma arising from the pericycle. Nodules also developed aerenchyma from the phellogen. Aerenchyma formation permits the diffusion of oxygen to the hypoxic tissues. Flooding resulted in a drastic reduction of xylem ureide and glutamine indicating impaired nitrogen fixation. The subsequent formation of aerenchyma coincided with the recovery of xylem ureides and glutamine, indicating some recovery of nitrogen fixation. Annals of Botany 96: 1191-1198, 2005. IF = 2.665 *E-mail: lsodek@unicamp.br
P046-05 Development of the nodulated soybean plant after flooding of the root system with different sources of nitrogen Thomas AL, Sodek L*The presence of nitrate during a period of flooding of the root system of nodulated soybean was found to be extremely beneficial towards the tolerance of the stress (hypoxia). Increases in total dry matter, plant height and leaf area were comparable to those of the non-flooded control. Although nitrate promoted a large increase in total N of the plant relative to the flooded N-free control, this was somewhat less than that seen in the non-flooded controls. Brazilian Journal of Plant Physiology 17: 291-297, 2005. *E-mail: lsodek@unicamp.br
P047-05 Evaluation of Eucalyptus spp. seedling size following germination using computer-aided analysis of digital images Dornelas MC*, Lobo CA, Vieira I Scientia Florestalis 68: 9-14, 2005.*E-mail: dornelas@unicamp.br
P048-05 Identifying Eucalyptus expressed sequence tags related to Arabidopsis flowering-time pathway genes Dornelas MC*, Rodriguez APM Brazilian Journal of Plant Physiology 17: 255-266, 2005. *E-mail: dornelas@unicamp.br
P049-05 Étude comparative de l´ expression du sexe chez le murier, Morus alba L. – Développement floral Fonseca TC, Almeida JE, Bandel G, Dornelas MC* Sericologia 45: 17-28, 2005. *E-mail: dornelas@unicamp.br
P050-05 The rubber tree (Hevea brasiliensis Muell.Arg.) homologue of the LEAFY/FLORICAULA gene is preferentially expressed in both male and female floral meristems Dornelas MC*, Rodriguez APM Journal of Experimental Botany 56: 1965-1974, 2005. IF = 3.336 *E-mail: dornelas@unicamp.br
P051-05 A FLORICAULA/LEAFY gene homolog is preferentially expressed in developing female cones of the tropical pine Pinus caribaea var. caribaea. Dornelas MC*, Rodriguez, APM Genetics and Molecular Biology 28: 299-307, 2005. IF = 0.373 *E-mail: dornelas@unicamp.br
P052-05 Physicochemical and structural analysis of three regions of the deep digital flexor tendon of pigs Feitosa VLC, Esquisatto MAM, Joazeiro PP, Gomes L, Felisbino SL, Pimentel ER* The deep digital flexor tendon of pigs, which experiences tensional (proximal region) and compressive (distal and terminal regions) forces were analyzed. The distal and terminal regions swelled more than the proximal region, when soaked in water, and also exhibited more intense metachromasy after toluidine blue staining, indicating an accumulation of proteoglycans in these regions. Analysis of glycosaminoglycans in agarose gel showed dermatan sulfate in all regions, while chondroitin sulfate was found only in the compressive regions. Rounded cells appeared in regions under compression, while in the region under tension, elongated cells were dominant. The birefringence analysis showed a more regular crimp pattern in the region under tension, than in the regions withstanding compressive forces. These results reinforce earlier studies showing that the compositional and organizational aspects of tendons depend on the type and intensity of the forces to which they are subjected. Brazilian Journal of Morphological Sciences 22: 113-119, 2005. (capa de revista) *E-mail: pimentel@unicamp.brP053-05 Distribution of small proteoglycans and glycosaminoglycans in humerus-related articular cartilage of chickens Rodrigues ED, Pimentel ER, Mourão PAS, Gomes L* Small proteoglycans and GAGs present in different cartilages of the chicken wing after extraction with guanidine chloride. Quantitative analysis of GAGs showed a larger amount in humeral cartilages than in articular cartilages of the radius and ulna. Analysis of the D4 fractions obtained by ultracentrifugation showed that fibromodulim may be present as macromolecular complexes of 160 and 200 kDa. Analysis of GAGs in HPLC, revealed abundant presence of a-L-glucuronic acid and N-acetyl ß-D-galactosamine. The DDi-4S:DDi-6S ratio was close to 3, except for the proximal cartilage of the radius (2.5). These results indicate possible functional differences between the chicken wing joints. This study contributes for the understanding of the physiology of cartilage and joints of birds under different types of mechanical stress. Brazilian Journal of Medical and Biological Research 38: 381-390, 2005. IF = 0.859 *E-mail: laure@unicamp.br
P054-05 In vitro effect of the Phoneutria nigriventer spider venom on cell viability, paracellular barrier function and transcellular transport in cultured cell lines Le Sueur LP, Collares-Buzato C, Kalapothakis E, Cruz-Höfling MA* Accidents caused by the army spider Phoneutria nigriventer cause a series of clinical symptoms including convulsion. Experimentally it was shown that the venom administered systemically causes impairment of the blood-brain-barrier in rats. In this work, ECV 304, MDCK and C6 glioma cells lines were used to assess the venom cytotoxicity, paracellular barrier function and transcellular transport. The in vitro studies showed a venom modestly cytotoxic, no able of impairing the interendotelial transport route but affecting the transcellular one. Toxicon 46: 130-141, 2005. IF = 2.255 *E-mail: hofling@unicamp.br
P055-05 Effects of neutrophil depletion in the local pathological alterations and muscle regeneration in mice injected with Bothrops jararaca snake venom Teixeira CFP, Chaves F, Zamunér SR, Zuliani JP, Fernandes CM, Cruz-Höfling MA*, Fernandes I, Gutiérrez JM Snakebites by vipers of the genus Bothrops produces a severe and fast-developing local inflammatory reaction whose complexity is poorly known and to which antivenom therapy is ineffective. An experimental model was designed to study the pathological local effects induced by the highly hemorrhagic but moderately myotoxic B. jararaca venom in mice skeletal muscle using either an anti-mouse granulocyte rat monoclonal immunoglobulin G, which induces a remarkable neutropenia, or an isotype-matched control antibody. Antibody administration was scheduled for maintaining neutropenia for 7 days and observations were made at 3, 24 h, 3, 7 and 30 days after envenoming. It was concluded that the profound microvasculature damage prevented effective access of inflammatory cells to remove necrotic areas and so providing adequate environment for regeneration. This fact would explain the lack of difference between neutropenic and control mice. International Journal of Experimental Pathology 86: 107-115, 2005. IF = 1.942 *E-mail: hofling@unicamp.br
P056-05 Analyses of regenerative bone matrix of rat tibia laser photo-excitation by SEM and AFM Baranauskas V, Garavello I, Jinguo Z, Cruz-Höfling MA* The reparative process of bone damage was investigated in an experimental rat model using HeNe laser irradiation to accelerate a surgically-made tibia injury. Irradiation (31.5 and 94.5 J cm-2) started 24 h after injury and applied daily for 7 and 14 days. Atomic force microscopy and scanning electron microscopy were employed to assess the 3-D molecular and structural organization during the healing process. The results showed that HeNe laser irradiation accelerated the formation of collagen fibrils and promoted enhanced spatial organization of the regenerating bone tissue. Applied Surface Science 248: 492-498, 2005. IF = 1.263 *E-mail: hofling@unicamp.br
P057-05 Morphological changes of Sertoli cells during the male reproductive cycle of the teleost Piaractus mesopotamicus (HOLMBERG, 1887) Cruz-Landim C, Abdalla FC, Cruz-Höfling MA* The function of Sertoli cells in fish is not well-established. In this study males specimens captured at the Pantanal Matogrossense (MS, Brazil) were anesthetized and the testes were processed for light and transmission electron microscopy. The results showed that the Sertoli cells (SC) were closely lining the germ line cells (cysts) during their development from spermatogonia to late spermatids and bundles of mature spermatozoa. Along the stages of spermatogenesis the SC acquired different morphological characteristics the most prominent of which was a progressive accumulation of numerous lipid droplets which peaked at the stage II (comprising spermatocytes, spermatids and even spermatozoa). In the stages that follows the SC regressed and spermatozoa resorption activity was seen. The results suggest that besides a support role for germ line cells, SC may be involved in several tasks, including creating a microenvironment inside the cysts for gamete maturation, steroidogenesis and resorption of cell remnants Brazilian Journal of Biology 65: 241-249, 2005. *E-mail: hofling@unicamp.br
P058-05 Theiler's murine encephalomyelitis virus in nonbarriers rats colonies Rodrigues DM, Martins SS, Gilioli R, Guaraldo AMA, Gatti MSV* Indirect immunofluorescense assay of rat serum samples, using serologic assays, RT-PCR analyses and clinical characterization, demonstrated antibodies against TMEV-GDVII in 86.3% of samples and 77.2% of the antibody-positive samples had neutralizing antibodies. To determine whether rats can be infected experimentally with TMEV-GDVII, specific pathogen-free newborn mice and rats were inoculated intracerebrally with intestinal suspensions from seropositive rats. Both species showed the typical clinical signs of TMEV infection in mice. RT-PCR in brain tissue of infected animals detected RNA sequences corresponding to the 5’ noncoding region of Cardiovirus known as the “internal ribosome entry site”, suggesting that rats can be naturally infected with TMEV and related Cardiovirus. Comparative Medicine 55: 459-464, 2005. IF = 1.084 *E-mail: msvgatti@unicamp.br
P059-05 Type 2 heat-labile enterotoxin (LT-II)-producing Escherichia coli isolates from ostriches with diarrhea Nardi ARM, Salvadori MR, Coswig LT, Gatti MSV*, Leite DS, Valadares GF, Garcia-Neto M, Shocken-Iturrino RP, Blanco JE, Yano T* Escherichia coli isolated from ostriches with diarrhea in Brazil and belonging to serotype O15:H8 contained the gene encoding (eltII-A) detected by polymerase chain reactions assays. The same methods not showed the presence of type I heat–labile enterotoxin (eltA), heat stable enterotoxins (estA, estB, verocytotoxins (stxI, stxII) or cytotoxic necrotizing factors (cnfI, cnfII) in these strains. The culture supernatant of these strains caused elongation in Vero cell, rounding in Chinese Hamster Ovary cell (CHO) and a cytoplasmic vacuolation in ostrich embryo fibroblasts (OEF). These same supernatant not showed citopatic effect in chicken embryo fibroblasts. These effects were not neutralized by antibodies against cholera toxin Veterinary Microbiology 105:245-249, 2005. IF = 2.175 *
P060-05 Non-pollinating wasps distort the sex ratio allocation of pollinating fig wasps Pereira RAS, Prado AP* In fig wasps, mating occurs among the offspring of one or a few foundress mothers within the fig, from which the mated females disperse to found new broods. Under these conditions, males will compete with each other for mating, and such local mate competition can result in female-biased sex ratios. Non-pollinating wasps species are also associated with figs and develop in flower ovaries or parasitize the larvae of primary galling wasps. While studying the fig wasp Pegoscapus tonduzi, which pollinates Ficus citrifolia in Brazil, we examined the influence of non-pollinating fig wasps on the sex ratio of species that pollinate F. citrifolia to determine whether the presence of no-pollinating wasps resulted in a distorted sex ratio. There was a positive relationship between the sex ratio of P. tonduzi and the number of non-pollinating wasps that was independent of the number of foundresses and brood size. This finding suggested that non-pollinating wasps had a direct effect in distorting the sex ratio of P. tonduzi broods. Our results indicate that the secondary sex ratio may not precisely reflect the primary sex ratio when there is a high infestation of non-pollinating fig wasps. Oikos 110:1-7, 2005. IF = 3.309*E-mail: apprado@unicamp.br
P061-05 Recognition of competitive asymmetries reduces the severity of fighting in male Idarnes fig wasps Pereira RAS, Prado AP* Intense sexual selection leading to male fighting in fig wasps is extensively documented and has evolved independently in several lineages of non-pollinating and pollinating fig wasps. We studied wingless males of non-pollinating Idarnes fig wasps, and observed assessment display and defensive behaviour (mating inside the female galls and sheltering within empty galls) during the mating period, in opposition to reported indications that such behaviour does not play an important role in the avoidance of fatal combats in fig wasps. Our results are consistent with models of asymmetric contest competition, and suggest that defensive behaviour and particular internal features of figs may increase the importance of the recognition of competitive asymmetries in reducing the severity of fighting in closed systems. Animal Behaviour 70: 249-256, 2005. IF = 2.669 *E-mail: apprado@unicamp.br
P062-05 A new species of the genus Neosilba (Diptera: Lonchaeidae) Strikis PC, Prado AP* A new species of the genus Neosilba McAlpine (Lonchaeidae) is described. This genus has a wide distribution in the Neotropical region and some of its species are considered to be fruit pests, n addition to fruit flies of the family Tephritidae. This genus is also known to have a cryptic complex of species, which makes species belonging to this genus difficult to identity. Zootaxa 828:1-4, 2005.*E-mail: apprado@unicamp.br
P063-05 Fecundidade de Dermanyssus gallinae (De Geer, 1778) (Acari: Dermanyssidae) em laboratório Tucci EC, Araújo RP, Prado AP* Estudou-se a fecundidade de Dermanyssus gallinae em condições de laboratório: fêmeas foram isoladas em pipetas “Pasteur” e mantidas em estufa climatizada sob 27 graus centígrados, 80% UR e 12:12 (C:E); as avaliações foram feitas no terceiro dia após a alimentação, ocasião em foi oferecida às fêmeas uma nova alimentação. Esta etapa foi repetida a cada três dias até o final do experimento. As fêmeas iniciaram a oviposição logo após o primeiro repasto sangüíneo e continuaram ovipondo após 7 alimentações. A maior percentagem das fêmeas (58.1%) ovipôs após a primeira alimentação. A partir do segundo repasto esta porcentagem foi diminuindo até a oitava alimentação, onde se recuperou apenas uma fêmea, que morreu antes de ovipor. Nesse experimento as fêmeas de D. gallinae foram capazes de realizar um total de sete oviposições, com uma produção total de 25 ovos. O padrão de oviposição de D. gallinae é do tipo declinante, ocorrendo um aumento no número de ovos após cada repasto até atingir um número máximo (terceira alimentação) e decrescendo nas alimentações subseqüentes. Arquivos do Instituto Biológico, São Paulo 72: 29-32, 2005.*E-mail: apprado@unicamp.br
P064-05 Survey of acarine fauna in dust samplings of curtains in the city of Campinas, SP, Brazil Binotti RS, Oliveira CH, Santos JC, Binotti CS, Muniz JRO, Prado AP* We investigated the mite fauna present in 33 living-room and 22 bedroom curtain dust samples from 41 different homes in the southern Brazilian city of Campinas, SP. A total of 148 mite bodies were found. Of these, 83 were found in living-room curtain samples (56.1% of total) and 65 were bedroom curtain dust samples (43.9%). The most frequently observed mite suborders were: Acaridida, Actinedida, Oribatida, and Gamasida. The most frequently families were Pyroglyphidae, Eriophyidae, Tarsonemidae, and Glycyphagidae. No statistical differences were observed between the number of mites found in the samples from living-room and bedroom curtains. Brazilian Journal of Biology 65: 25-28, 2005.*E-mail: apprado@unicamp.br
P065-05 Increased sensory neuron apoptotic death two weeks after peripheral axotomy in C57BL/6J mice compared to A/J mice Pierucci A, Oliveira ALR* Peripheral, lesion-induced, neuronal loss also occurs in adults, and is particularly evident in mouse sensory neurons. Differences in genetic background cause particular isogenic strains of mice to react unevenly to peripheral nerve lesion. We investigated the occurrence of apoptosis and fine structural changes in the dorsal root ganglion sensory neurons and satellite cells of C57BL/6J and A/J mice two weeks after ipsilateral sciatic nerve transection at the mid-thigh level. C57BL/6J mice displayed a stronger sensory neuron chromatolytic reaction that resulted in an increased loss of neurons when compared with isogenic A/J mice. Most of the degenerating neurons displayed the classic features of apoptosis. These results reinforced data previously obtained by the TUNEL technique. Neuroscience Letters, 2005. [Epub ahead of print], PMID: 16359790. IF = 1.898 *E-mail: alrovi@unicamp.br
P066-05 The use of hydroxyapatite and autogenous cancellous bone grafts to repair bone defects in rats Silva RV, Camilli JÁ*, Bertran CA, Moreira NH The objective of this study was to evaluate the repair of bone defects by autogenous cancellous bone grafts or porous bioceramic discs of hydroxyapatite/phosphate cement mixture. Two 5-mm diameter defects were made in the skulls of rats and filled with the bioceramic material or cancellous bone. The rats were sacrificed 2, 4, 8 and 24 weeks after surgery and tissue samples were analyzed by radiography and histology. By the 24th week, the defects filled with autogenous cancellous bone grafts or bioceramic material showed similar volumes of bone tissue within the defect. The results indicated that the osteointegration of bioceramic fragments allowed the reconstruction of parietal bone defects without the need for a bone graft. International Journal of Oral and Maxillofacial Surgery 34: 178-184, 2005. IF = 1.123 *Phone: 19-3788-6101
P067-05 Zygomatic bone: anatomical bases for osseointegrated implant anchorage Rigolizzo MB, Camilli JA*, Francischone CE, Brånemark PI Bilateral measurements of zygomatic bone thickness, in areas previously standardized in the form of quadrants (Q), were made on dry skulls. Quadrants located in appropriate areas for implant anchorage presented the following thickness mean values: Q5 = 6.05mm, Q6 = 3.15mm, Q8 = 6.13mm and Q9 = 4.75mm. The results showed that in most quadrants there was no statistical difference among the locations. The relationship between the quadrant thickness and CI, Q6 and Q8 varied independently of CI. Q5 associated with the Brachycephalic CI, and Q9 associated with Sub-brachycephalic CI, presented variations in the corresponding thickness. Based on the results, implants should be placed in Q5 and Q8, since they present the greatest thickness, except for Brachycephalic and Sub-brachycephalic subjects in Q5 and Q9 quadrants respectively. We concluded that the CI for this sampling did not prove to be an appropriate parameter for evaluating zygomatic bone thickness value. International Journal of Oral & Maxillofacial Implants 20: 441-447, 2005. IF = 1.412 *Phone: 19-3788-6101
P068-05 Muscle regeneration in dystrophic mdx mice is enhanced by isosorbide dinitrate Marques MJ, Luz MAM, Minatel E, Santo-Neto H* We investigated whether isosorbide dinitrate (ISD), an NO donor, could improve muscle regeneration in dystrophic mdx mice. The tibialis anterior muscle of mdx and C57BL/10 mice was injected with bupivacaine to induce muscle fiber regeneration. After bupivacaine injection, mice were treated with ISD, verapamil (a non-NO donor vasodilator) or saline solution for 20 days. Muscle regeneration was evaluated by counting the total number of muscle fibers and measuring myofiber cross-sectional area. ISD significantly improved bupivacaine-induced muscle regeneration in mdx by increasing by 20% the total number of muscle fibers compared to the other groups and not affect myofiber cross-sectional area. Neuroscience Letter 382: 342-345, 2005. IF = 1.898 *E-mail: marques@unicamp.br
P069-05 Cryopreserved muscle basal lamina grafts retain their grafting potential for nerve repair Santo Neto H*, Sabha Jr MJJ, Marques MJ* The effect of cryopreservation on the ability of muscle basal lamina grafts to repair nerve lesions was studied. Basal lamina grafts were prepared and cryopreserved for different times and at different temperatures. Their grafting potential was evaluated by examining axonal regeneration after autografting to lesions in rat sciatic nerves. Muscle basal lamina grafts cryopreserved for up to 30 weeks (-20°C and -40°C) were successfully used. We concluded that muscle basal lamina autografts retain their potential usefulness for nerve repair after cryopreservation, providing a basis for the development of a bioprosthesis from muscle basal lamina. Cryobiology 50: 112-115, 2005. IF = 1.765 *E-mail: marques@unicamp.br
P070-05 Trigeminal neuralgia is caused by maxillary and mandibular nerve entrapment Santo Neto H*, Camilli JÁ, Marques MJ* Trigeminal neuralgia (TN) is the most important disease of the trigeminal nerve. Anatomical and radiological studies have shown that the rotundum and ovale foramens on the right side of the human cranium are significantly narrower than on the left side. The rotundum and ovale foramens are crossed by the maxillary and mandibular nerves, respectively, and are the nerves most affected in TN. Based on demographic and epidemiological data of TN patients, and on anatomical findings in the foramens, we hypothesized that entrapment of the maxillary and mandibular nerves when they cross the ovale and rotundum foramens is a primary cause of TN and accounts for the higher incidence of TN on the right sided. Medical Hypotheses 65: 1179-1182, 2005. IF = 0.920 *E-mail: marques@unicamp.br
P071-05 Microvessel damage by B. jararacussu snake venom: pathogenesis and influence on muscle regeneration Santo Neto H*, Marques MJ* We investigated the pathogenesis of microvessel damage caused by B. jararacussu venom. The right soleus muscle of adult mice was injected with 80 g of venom and the mice were killed from 2 min to 3 months later. The soleus muscle of other mice was injected with 80 g of bothrosptoxin-I. The time-course of ultrastructural lesions suggests that endothelial cells were damaged possibly due to a direct action of B. jararacussu venom on these cells. This study provides evidence for a central role of vascular lesions on impaired muscle regeneration after B. jararacussu envenomation Toxicon 46: 814-819, 2005. IF = 2.255 *E-mail: marques@unicamp.br
P072-05 Ultrastructural changes on the hard palatine mucosa of Calomys callous after 120 days of experimental chronic alcoholism Martinez M, Milton FA, Oliveira AS, Lima NF, Segatelli TM, Pinheiro PFF, Almeida CCD, Mello JR, Cagnon-Quitete VA*, Martinez FE The present study analyzed the toxic effects of chronic alcohol ingestion on the ultrastructure of the lining epithelium of the hard palatine mucosa of the rodent (Calomys callosus). Twenty-six adult animal aged three months were divided into two experimental groups. Control group; received solid diet and water. Alcoholic group; received the same solid diet and ethanol diluted 20% in water. The epithelial cells of the alcoholic group showed lipid droplets, nuclei in corneum layer, nuclei with increase peripheral chromatin and greater electron density. It was concluded that 20% ethanol causes lesions in the hard palatine mucosa, compromising its functional capacity. Journal of submicroscopic Cytology and Pathology 37: 59-65, 2005. *E-mail: quitete@unicamp.br
P073-05 Stereology and ultrastructure of the salivary glands of diabetic NOD mice submitted to long-term insulin treatment Caldeira EJ, Camilli JÁ, Cagnon VHA* Insulin- dependent diabetes mellitus compromises the salivary glands, altering their morphology and the mechanisms of salivation. Thus, the aim of the present study was to determine the effects of prolonged insulin treatment on the morphology of the salivary glands in Nod mice. Forty-five female mice were divided into groups: positive diabetic Nod mice for 10 days (I), positive diabetic Nod mice for 20 days (II), diabetic Nod mice for 10 days (III), diabetic Nod mice for 20 days (IV), and non-diabetic BALB/c mice (V). Animals of groups III and IV received 4 to 5 U of insulin daily. Samples of the salivary glands were analyzed by light, transmission and scanning electron microscopies. The results showed alterations in diabetic animals. Insulin treatment caused recovery of the changes resulting from the diabetic state in both parotid and submandibular glands. In addition to compromising the processes of tissue maintenance and renewal, tissue destructuring leads to alterations in functional mechanisms in both diabetic animals and animals submitted to glycemic control. Anatomical Record Part A-Discoveries in Molecular Cellular and Evolutionary Biology 286A: 930-937, 2005. IF = 1.807 *E-mail: quitete@unicamp.br
P074-05 Effects of structural and functional connectivity and patch size on the abundance of seven Atlantic Forest bird species Uezu A, Metzger JP, Vielliard JME* Biological Conservation 123: 507-519, 2005. IF = 2.581 *E-mail: 19-3788-6313
P075-05 Physiology studies on Alstroemeria (Alstroemeraceae) hybrid, a new cut-flower for the Brazilian market Valio IFM*, Dias-Tagliacozzo GM, Tombolato AFC Acta Horticulturae 683: 287-291, 2005. *Phone: 19-3788-6219
P076-05 Sugarcane yellow leaf vírus (ScYLV) infection leads to alterations in photosynthetic efficiency and carbohydrate accumulation in sugarcane leaves Gonçalves MC, Vega J*, Oliveira JG, Gomes MMA Fitopatologia Brasileira 30: 10-16, 2005. *E-mail: jvega@unicamp.br
P077-05 Studies on aphid transmission and Buchnera GroEL affinity of a potato leafroll virus RTD deficient mutant Gonçalves MC, Verbeek M, Vega J*, Heuvel VD Fitopatologia Brasileira 30: 259-266, 2005. *E-mail: jvega@unicamp.br
P078-05 Dehydrocrotonin and its beta-cyclodextrin complex: cytotoxicity on V79 cells and rat cultured hepatocytes Correa DHA, Melo PS, Carvalho CAA, Azevedo MM, Duran N, Haún M* European Journal of Pharmacology 510: 17-24, 2005. IF = 2.477 *E-mail: secrbq@unicamp.br
P079-05 Comparative toxicity of emuents processed by different treatments in V79 fibroblasts and the algae Selenastrum capricornutum Meio PS, Fabrin Neto JB, Moraes SG, Assalin MR, Duran N, Haún M* Chemosphere 62: 1207-1213, 2005. IF =2.477 *E-mail: secrbq@unicamp.br P080-05 Effectiveness of Metarhizium anisopliae against immature stages of Anastrepha fraterculus fruit f1y (Diptera: Tephritidae) Destéfano RHR, Bechara IJ*, Messias CL, Piedrabuena AE' Brazilian Journal of Microbiology 36: 94-99, 2005. IF = 0.165 *E-mail: ivanira@unicamp.br P081-O5 Aqueous extraction of recombinant human proinsulin from transgenic maize endosperm Farinas CS, Leite A, Miranda EA * Biotechnology Progress 21: 1466-1471, 2005. IF = 1.985 *E-mail: everson@feq.unicamp.br
P082-O5 Aqueous extraction of maize endosperm: insights for recombinant protejo hosts based on downstream processing Farinas CS, Leite A, Mirando EA * Process Biochemistry 40: 3327-3336, 2005. IF = 1.796 *E-mail: everson@feq.unicamp.br
P083-05 Nitrite as the major source of nitric oxide production by Arabidopsis thaliana in response to Pseudomonas syringae Modolo L V, Augusto O, Almeida IMG, Magalhães JR, Salgado 1* FEBS Letters 579: 3814-3820, 2005. IF = 3.415 *E-mail: ionesm@unicamp.br
P084-05 Neuronal nitric oxide synthase is heterogeneously distributed in equine myofibers and highly expressed in endurance trained horses Gondim FJ, Modolo LV, Campos GER, Salgado 1* The present study reveals that neuronal nitric oxide synthase is differently expressed and localized in the gluteus medius according to the fiber type and the athletic conditioning of the horses. Canadian Journal of Veterinary Research 69: 46-52, 2005. IF = 0.802 *E-mail: ionesm@unicamp.br
P085-05 Effect of excess cadmium and zinc iDOS on roots and shoots of maize seedlings Souza JF, Dolder MAH, Cortelazzo AL * Journal of Plant Nutrition 28: 1923-1931, 2005. IF = 0.497 *E-mail: angelo@unicamp.br
P086-05 A cultura da baunilheira - generalidades e propagação Stancato GC, Hofstatter PG, Cortelazzo AL * Orquidário 19: 13-16, 2005. *E-mail: angelo@unicamp.br
P087-05 Storage and ageing of French bean (Phaseolus vulgaris L.): effect on seed viability and vigor Cortelazzo AL *, Coutinho J, Grarifeiro P A Brazilian Journal of morphological Sciences 22: 121-128, 2005. *E-mail: angelo@unicamp.br
P088-05 Puncture wounds by driftwood catfish during bucket baths: local habits of riverside people and fish natural history in the Amazon Sazima 1*, Zuanon J, Haddad V Wilderness & Environmental Medicine 16: 204-208, 2005. IF = 0.585 *E-mail: isazima@unicamp.br
P089-05 Little dragons prefer flowers to maidens: a lizard that laps nectar and pollinates trees Sazima 1*, Sazima C, Sazima M Biota neotropica 5: 1-8, 2005. *E-mail: isazima@unicamp.br
P090-05 Free meals on long-distance cruisers: the vampire fish rides giant catfishes in the Amazon Zuanon J, Sazima 1* Biota neotropica 5: 109-114, 2005. *E-mail: isazima@unicamp.br
P091-05 Natural history notes: Euprepis atlanticus (Noronha Skink) predation Silva Jr JM, Peres Jr AK, Sazima 1* Herpetological Review 36: 62-63, 2005. *E-mail: isazima@unicamp.br
P092-05 The glassy sweeper's way: seeking a versatile wrasse to be cleaned Sazima C, Krajewski JP, Bona/do RM, Sazima 1* Neotropical Ichthyology 3: 111-114, 2005. *E-mail: isazima@unicamp.br
P093-05 The Noronha wrasse: a jack-of-all-trades follower Sazima C, Bonaldo RM, Krajewski JP, Sazima 1* Aqua Journal of Ichthyology and Aquatic Biology 9: 97-108, 2005. *E-mail: isazima@unicamp.br
P094-05 Rest, nurture, sex, release, and play: diurnal underwater behaviour of the spinner dolphin at Fernando de Noronha Archipelago, SW Atlantic Silva Jr JM, Silva FJL, Sazima 1* Aqua Journal of Ichthyology and Aquatic Biology 9: 161-176, 2005. *E-mail: isazima@unicamp.br
P095-05 Reproduction and feeding of tbe colubrid snake Tomodon dorsatus from southeastern Brazil. Bizerra A, Marques OAV, Sazima 1* Ampbibia-Reptilia 26: 33-38, 2005. IF = 0.547 *E-mail: isazima@unicamp.br
P096-05 Amphibian declines in Brazil: an overview Eterovick PC, Carnaval ACOQ, Borges-Nodosa DM, Silvano DL, Segalla MV, Sazima I* Biotropica 37: 166-179, 2005. IF = 1.094 *E-mail: isazima@unicamp.br
P097-05 Meals for two: foraging activity of tbe butterfish Chaetodon striatus (Perciformes ) Bona/do RM, Krajewski JP, Sazima 1* Brazilian Journal of Biology 65: 211-215, 2005. *E-mail: isazima@unicamp.br
P098-05 The ogre catfish: prey scooping by tbe auchenipterid Asterophysus batrachus Zuanon J, Sazima 1* Aqua Journal of lchthyology and Aquatic Biology 10: 15-22, 2005. *E-mail: isazima@unicamp.br
P099-05 Wolf in a sheep's clothes: juvenile coney (Cephalopholis fulva) as an aggressive mimic of tbe brown chromis (Chromis multilineata) Sazima 1*, Krajewski JP, Bonaldo RM, Sazima C Neotropical Ichthyology 3: 315-318, 2005. *E-mail: isazima@unicamp.br
P100-05 Two presumed interspecific hybrids in tbe genus Stenella (Delphinidae) in the tropical West Atlantic Silva Jr JM, Silva FJL, Sazima 1* Aquatic Mammals 31: 468-472, 2005. *E-mail: isazima@unicamp.br
P101-05 Marine ornamental trade in Brazil Gasparini JL, Floeter SR, Ferreira CEL, Sazima 1* Biodiversity and Conservation 14: 2883-2899, 2005. IF = 1.401 *E-mail: isazima@unicamp.br
P102-05 The sharksucker (Echeneis naucrates) attached to a tucuxi dolphin (Sotalia guianensis) in estuarine waters in south-eastern Brazil Santos MCO, Sazima 1* JBMA - Biodiversity Records 2: 1-2, 2005. *E-mail: isazima@unicamp.br
P103-05 Leukotrienes play a role in the control of parasite burden in murine strongyloidiasis Machado ER, Ueta MT*, Lourenço EV, Anibal FF, Sorgi CA, Soares EG, Roque-Barreira MC, Medeiros AI, Faccioli LH Mice infected with Strongyloides venezuelensis and treated with MK886 show the number of worms and epg greater than in infected-only animals, indicating inhibition of leukotriene B4 production. Parasite burdens were greater in 5-lipoxygenase-/- mice than in wild-type animals. This treatment promoved lower numbers of eosinophils and mononuclear cells, inhibited IgE and IgGl synthesis and also inhibited synthesis of IL-5 at the begining of infection, whereas levels of IL-12 increased throughout the postinfection period. The findings indicate potencial immunostimulatory strategies involving leukotriene administration and may serve as an alert to treating S. stereoralis-infected patients presenting asthma-like symptoms because use of 5-lipoxygenase inhibitors may worsen the infection. Journal of Immunology 175: 3892-3899, 2005. IF = 6.387 *E-mail: mtu@unicamp.br
P104-05 Influence of saccharose on the development of cercariae from Schistosoma mansoni strains BH and SJ Bruno TIB, Zanotti-Magalhães EM*, Magalhães LA, Carvalho JF Estudou-se, em B. glabrata e B. tenagophila tratada com sacarose a 0,01%, o desenvolvimento do Schistosoma mansoni das linhagens BH e SJ. Não se observou diferença significativa entre as taxas de infecção dos moluscos tratados ou não com sacarose. B. glabrata foi mais suscetível ao S. mansoni do que B. tenagophila. Menor taxa de sobrevivência foi observada em moluscos tratados com sacarose, sendo a maior mortalidade observada no início e logo após a liberação das cercárias. Cercárias oriundas de moluscos tratados com sacarose apresentaram maior capacidade de penetração na pele de camundongos, devido provavelmente ao maior suprimento de energia durante o desenvolvimento destas larvas no molusco. Brazilian Journal of Biology 65: 43-49, 2005. *E-mail: emzrn@unicamp.br
P105-05 Seleção genética de Biomphalaria glabrata e Biomphalaria tenagophila visando a alteração da suscetibilidade e resistência ao Schistosoma mansoni Zuim NRB, Zanotti-Magalhães EM*, Magalhães LA, Linhares AX Foi estudada a adaptação do S. mansoni das linhagens BH e SJ em populações de B. glabrata e B. tenagophila selecionadas geneticamente para a suscetibilidade e resistência ao trematódeo. Utilizando-se várias gerações de moluscos selecionados por autofecundação e expostas à infecção pelo S. mansoni verificou-se que o aumento da suscetibilidade foi mais facilmente obtido do que o aumento da resistência. Este resultado é extremamente importante para a epidemiologia da esquistossomose mansônica. Revista da Sociedade Brasileira de Medicina Tropical 38: 387-390, 2005. *E-mail: ernzm@unicamp.br
P106-05 Behavior in Mus musculus of Schistosoma mansoni from mollusks treated with hydrocortisone Serrano DR, Zanotti-Magalhães, EM*, Magalhães LA, Carvalho JF Cercárias oriundas de Biomphalaria glabrata tratada com hidrocortisona foram utilizadas para infecção de camundongos. O tratamento dos moluscos com hidrocortisona aumenta suscetibilidade ao parasita, porém as cercárias produzidas não tiveram sua capacidade de penetração na pele de camundongos alterada quando comparada com a capacidade de penetração de cercárias provenientes de moluscos não tratados com hidrocortisona. Maior número de vermes fêmeos e de vermes acasalados e maior número de ovos nas fezes foram observados em camundongos infectados com cercárias de moluscos tratados com hidrocortisona. Revista da Sociedade Brasileira de Medicina Tropical 38: 406-409, 2005. *E-mail: emzm@unicamp.br
P107-O5 Origin and diversification of the human parasite Schistosoma mansoni Morgan JAT, DeJong RJ, Adeoye GO, Ansa EDO, Barbosa CS, Brémond P, Cesari IM, Charbonnel N, Corrêa LR, Coulibaly G, D'Andrea PS, Souza CP, Doenhoff MJ, File S, Idris MA, Incani RN, Jarne P, Karanja DMS, Kazibwe F, Kpikpi J, Lwambo NJS, Mabaye A, Magalhães LA*, Makundi A, Moné H, Mouahid G, Muchemi GM, Mungai BN, Séne M, Southgate V, Tchuenté LAT, Théron A, Yousif F, Zanotti-Magalhães EM, Mkoji GM, Loker ES Estudo filogeográfico do S. mansoni foi realizado utilizando a seqüência de DNA mitocondrial de 143 parasitas coletados em 53 localidades geográficas. O estudo revelou uma maior diversidade genética do trematódeo na África, devido principalmente ao isolamento geográfico entre as populações. Esta maior diversidade se deve ao fato desta espécie ter surgido no continente africano em épocas remotas. No Novo Mundo esta diversidade é muito menos acentuada, devido naturalmente a recente colonização. Todos os isolados brasileiros mostraram identidade de sua constituição genética. Molecular Ecology 14: 3889-3902, 2005. IF = 4.301 *E-mail: lam@unicamp.br
P108-05 Expression of hypoxia-inducible factor-l(HIF-l) in the cutaneous lesions of Balb/c mice infected with Leishmania amazonensis Arrais-Silva WW, Paffaro Jr VA, Yamada AT, Giorgio S* Immunohistochemical analyses of the leishmaniallesions demonstrated positive HIF-l infected cells throughout the lesions, only in the later stages of infection when the lesion size is maximal and parasite burden is enormous and massive numbers of recruited macrophages and ulcers are observed. HIF-l is expressed mainly in the cytoplasm and around parasites inside the parasitophorous vacuoles of macrophages. This is the first evidence that macrophages in the microenvironment of lesions caused by a parasite produce a hypoxia-inducible factor. Experimental and Molecular Pathology 78: 49-54, 2005. IF = 2.089 *E-mail: sgiorgio@unicamp.br
P109-05 Effects of hyperbaric oxygen on Leishmania amazonensis promastigotes and amastigotes Arrais-Silva WW, Colhone MC, Ayres DC, Souto PCS, Giorgio S* The hyperbaric oxygen (HBO) treatment protocols induced irreversible metabolic damage and affected parasite morphology, growth and ability to transform. The observation that the antioxidant N-acetylcysteine prevents some of these deleterious effects indicated an involvement of oxidative stress during parasite HBO exposure. Furthermore, HBO exposed L. amazonensis-infected macrophage cultures showed reduction of the percentage of infected cells and of the number of intracellular parasites per cell. The demonstration that HBO is toxic for both L. amazonensis life stages and can alter macrophage susceptibility to the infection encourages further studies of this therapy in animal models of Leishmania infection. Parasitology International 54: 1-7, 2005. IF = 1.280 *E-mail: sgiorgio@unicamp.br
P110-05 Chromosomal characterization of taxa of the genus Trinomys in the states of Rio de Janeiro and São Paulo (Rodentia: Echimyidae) Pessôa LM, Corrêa MMO, Bitencourt E, Reis SF* We describe the normal chromosomal complement for taxa, Trinomys gratiosus bonafidei (Fazenda Boa Fé, Rio de Janeiro, type-locality), Trinomys eliasi (Barra de Maricá, Rio de Janeiro, type-locality) and Trinomys dimidiatus (Rio Bonito, Rio de Janeiro and Ubatuba, São Paulo). The specimens from the Ubatuba were identified on the basis of craniodental, pelage, and bacular traits, extending the know range at least 100km south into the State of São Paulo. The three taxa differ in their diploid and fundamental numbers of chromosome and can be diagnosed on the basis of their karyotypes. The significance and implications of chromosome numbers and morphology as diagnostic markers are evaluated in the framework of the molecular phylogenetic relationships and of the data on geographic distribution available for the genus Trynomys. Arquivos do Museu Nacional 63: 161-168,2005. *E-mail: sfreis@unicamp.br
P111-05 A multi-neighbor-joining approach for phylogenetic tree reconstruction and visualization Silva AEA, Villanueva WJP, Knidel H, Bonato V, Reis SF*, Von Zuben FJ This study proposed a multi-neighbor-joining (MNJ) algorithm capable of performing multiple pairing decisions at each level of the tree reconstruction, keeping various partial solutions along the recursive execution of the NJ algorithm. The advantages of the new reconstruction procedure are: 1) the MNJ algorithm is still a low-cost reconstruction method; 2) a further investigation of the alternative topologies may reveal stable and unstable sub-trees; 3) the chance of achieving the minimum evolution tree is greater; 4) tree topologies with similar performances will be simultaneously presented at the output. When there are multiple unrooted tree topologies to be compared, a visualization tool is proposed, using a radial layout to uniformly distribute the branches with the help of well-know metaheuristics used in computer science. Genetics and Molecular Research 4: 525-534, 2005. *E-mail: sfreis@unicamp.br
P112-05 Two new species of Brachycephalus Günther, 1858 (Amphibia: Anura: Brachycephalidae) from State of Paraná, southern Brazil Ribeiro LF, Alves ACR. Haddad CFB, Reis SF* The new species share the attributes: body bufoniform; skin on dorsum of head and central body smooth, with no dermal co-ossification; outer metatarsal tubercle distinct; dermal roofing bones of skull unornamented; all paried cranial bones distinct, not fused; quadratojugals, neopalatines, and maxillary odontoids present. Brachycephalus izecksohni sp.nov., characterized by male SVL=10.3-12.1 mm and female SVL=12.513.1 mm; general colour orange; snout rounded in dorsal view; absence of external trace of toe V. Brachycephalus brunneus sp.nov., is characterized by male SVL=9.3-11.3 mm and female SVL=10.9-12.0 mm; general colour brown; snout mucronate in dorsal view; presence of external trace of toe V. Boletim do Museu Nacional 519: 1-18, 2005. *E-mail: sfreis@unicamp.br
P113-05 Random initial condition in small Barabasi-Albert networks and deviations from the scale-free behavior Guimarães PR, Aguiar MAM, Bascompte J, Jordano P, Reis SF* Barabasi-Albert networks are constructed by adding nodes via preferential attachment to an initial core of nodes. The topology of small scale-free networks as a function of the size and average connectivity of their initial random core was studied. These two parameters may strongly affect the tail of the degree distribution, be consistently leading to broad-scale or single-scale networks. The size of the initial network core and its density of connections may be the main responsible for the exponential truncation of the power-law behavior observed in some small scale-free networks. Physical Review E 71: 1-4, 2005. IF = 2.418 *E-mail: sfreis@unicamp.br
Pl14-05 Morphological evolution in the mandible of spiny rats, genus Trinomys (Rodentia: Echimyidae) Monteiro LR, Reis SF* Using techniques for the geometric analysis of shape, we have combined developmental information with a powerful quantification of shape variation and an independent estimate of phylogeny to assess the evolutionary patterns of shape change in mandibles of the rodent genus Trinomys. Generally, the major trends in shape variation did not agree with the expected phylogenetic pattem. However, for small-scale morphological differences, one species (T. yonenagae) was responsible for the lack of association between morphology and molecular divergence. This species is genetically similar to but morphologically different from other Trinomys. The coronoid process was considered to be the most conservative morphogenetic component in the mandible. Journal of Zoological Systematics and Evolutionary Research 43: 332-338, 2005. IF = 1.177 *E-mail: sfreis@unicamp.br
P115-05 Evolutionary integration and morphological diversification in complex morphological structures: the mandible shape of echimyid rodents Monteiro LR, Bonato V, Reis SF* We use a combination of geometric and multivariate morphometric methods in order to assess the correspondence between integration patterns and a priori biological models in the context of evolutionary shape divergence in the mandible of Echimyidae rodents. The correlation of shape distances among operational taxonomic units in separate morphogenetic components allowed the construction of integration matrices among mandible components for data sets corresponding to varying levels of genetic divergence. Developmental and genetic models were significantly associated with the interspecific integration patterns observed, suggesting a role for neutral evolution during the evolutionary divergence of mandible shape. However, directional and stabilizing selection were not discarded as processes responsible for the generation of interspecific integration. The choreography of the morphogenetic components in the mandible is highly flexible and the integrated groups of components can be reorganized depending on functional demands during evolutionary shape changes. Evolution & Development 7: 429-439, 2005. IF = 3.390 *E-mail: sfreis@unicamp.br
Pl16-05 An ultrastructural and histopathological study of Henneguya pellucida n.sp. (Myxosporea: Myxobolidae) infecting Piaractus mesopotamicus (Characidae) cultivated in Brazil Adriano ES, Arana S, Cordeiro NS* Henneguya pellucida n.sp. was described from juvenile specimens of Piaractus mesopotamicus, with 8.3% of prevalence. Round yellow plasmodia measuring 0.5 3mm were found in the serous membrane of the visceral cavity and in the tunica externa of the swim bladder, where was noted thickening of the tunica externa and a granulomatous reaction. Sporogenesis was asynchronous, with the earliest developmental stages aligned prevailing along the endoplasmic periphery and mature spores in the central zone. There was no correlation between the prevalence of the parasite and the chemical and physical characteristics of the water. Parasite 12: 221-227, 2005. IF = 0.844 *E-mail: nsilvac@unicamp.br
P117-05 Histopathology and ultrastructure of Henneguya caudalongula n.sp. infecting Prochilodus lineatus (pisces: Prochilodontidae) cultivated in the state of São Paulo, Brazil Adriano EA, Arana S, Cordeiro NS* Henneguya caudalongula n.sp.is found in the inter- and intralamellar regions of the gills of Prochilodus lineatus cultivated at CEPTA, in the municipality of Pirassununga, SP, Brazil. The plasmodia were white and round or ellipsoidal and measured 0.2 to l mm in length. Development was asynchronous and the mature spores were fusiform. The polar capsules were elongate and of equal size; polar filament was coiled in 10-11 turns. The prevalence of the parasite was 48.3% and did not vary with the season or host size. Memórias do Instituto Oswaldo Cruz 100: 177-181,2005. IF = 0.847 *E-mail: nsilvac@unicamp.br
P118-05 Histology, ultrastructure and prevalence of Henneguya piaractus (Myxosporea) infecting the gills of Piaractus mesopotamicus (Characidae) cultivated in Brazil Adriano EA, Arana S, Cordeiro NS* The histological analysis of Henneguya piaractus, a parasite of the gill lamellae of Piaractus mesopotamicus showed that the plasmodia were of the intralamellar type. The development of the plasmodia resulted in marked dilatation of the infected lamellae, with the neighbouring lamellae being displaced laterally. The prevalence of the parasite varied according to host size, with the lowest prevalence occurring in hosts up to 10 cm long. Diseases of Aquatic Organism 64: 229-235, 2005. IF = 1.361 *E-mail: nsilvac@unicamp.br
Pl19-05 The value of PCR-RFLP molecular markers for the differentiation of immature stages of two necrophagous flies (Diptera: Calliphoridae) of potential forensic importance Thyssen P J, Lessinger AC, Azeredo-Spin AML, Linhares AX* Hemilucilia segmentaria (Fabricius) and Hemilucilia semidiaphana (Rondani) (Diptera: Calliphoridae) are morphologically and behaviorally similar, but differ in their growth and maturation rates. These species are exclusively necrophagous and are of potential medicolegal importance for estimating the post-morten interval (PMI) in criminal events that would take place in forest areas. In view of the difficulties associated with identification by morphological characteristics, we assessed the PCR-RFLP in the differentiation of these species. This method can be helpful for the forensic entomologist in estimating the PMI because it provides a fast identification, also making possible the use of the insect at any life stage, regardless of the conditions of preservation. Neotropical Entomology 34: 777-783, 2005. *E-mail: aricio@unicamp.br
P120-05 Isolation and isoenzyme characterization of Leishmania (Viannia) braziliensis from a case of human cutaneous leishmaniasis in northeast centre of the state of São Paulo Pinto MC, Rosa JA, Fernandes 2MT, Graminha MAS, Mine JC, Allegretti SM*, Benincasa JAC, Delort S, Riedel C, Paes EL, Cupolillo E. Isolation of a Leishmania strain from a patient of Rincão, state of São Paulo, that was identified by isoenzyme charaterization as L.(Viannia) braziliensis was reported. Memórias do Instituto Oswaldo Cruz 100: 733-734, 2005. IF = 0.847 *E-mail: sallegre@unicamp.br
P121-05 Characterization and histopathological observations of a selected Brazilian precocious line of Eimeria acervulina Kawazoe U*, Bordin EL, Lima CA, Dias LAV Two precocious lines of Eimeria acervulina were avaliated for pathogenicity. There are no significant difference in E. acervulina "l' precocious line, suggesting a low degree of attenuation. The histopathological observations of chickens infected with "Cu" parent strain and precocious line showed: 1) parasites stages only in the border cells of intestinal villi, for the precocious line, 2) parasites also in submucosa cells near the Lieberkühn glands, 3) high degree of inflammatory cells around the parasite in the parent strains. This Brazilian "Cu" precocious line showed attenuation for pathogenicity in chickens, suggesting that it could be a suitable strain for use as a live vaccine in Brazil. Veterinary Parasitology 131: 5-14, 2005. IF = 1.686 *E-mail: urara@unicamp.br
P122-05 Evaluation of immobilized metal peva membrane affinity chromatography for purification of IgG1 monoclonal antibody Serpa G, Augusto EFP, Tamashiro WMSC*, Ribeiro MB, Miranda EA, Bueno SMA A produção de anticorpos monoclonais em larga escala vem criando a necessidade de se aperfeiçoar métodos de purificação eficientes desse produto. Nesse sentido, a adsorção de afinidade convencional em beads fixos vem sendo substituída com vantagens pela cromatografia de afinidade a íons metálicos imobilizados em membranas. No presente trabalho, uma membrana de poli(etileno vinil álcool) ligada a íons metálicos (Me2+-IDA-PEVA) foi empregada para purificar uma preparação de anticorpo monoclonal anti-TNP do isotipo IgG1. A pureza da IgG1 foi alta quando eluída de complexos de Zn 2+, sem perda da sua capacidade ao ligante específico. Assim, esse procedimento pode ser considerado uma alternativa eficiente à purificação de imunoglobulinas IgG1 por cromatografia de afinidade em proteína G-Sepharose. Journal of Chromatography B-Analytical Technologies in the Biomedical and Life Sciences 816:259-268, 2005. IF = 2.391 *E-mail: wirlatam@unicamp.br
P123-05 Morphological Characterization of a Human Glioma Cell Line Machado CML, Schenka A, Vassallo J, Tamashiro WMSC*, Gonçalves EM, Genari SC, Verinaud L A human malignant continuous cell line, named NG97, was recently established in our laboratory. This cell line has been serially subcultured over 100 times in standard culture media presenting no sign of cell senescence. Immunocytochemical analysis of glial markers demonstrated that cells are positive for glial fibrillary acidic protein (GFAP) and S-100 protein, and negative for vimentin. Under phase-contrast microscope, cultures of NG97 showed cells with variable morphological features, such as small rounded cells, fusiform cells (fibroblastic-like cells), and dendritic-like cells. However, at confluence just small rounded and fusiform cells can be observed. At scanning electron microscopy small rounded cells showed heterogeneous microextentions, including blebs and filopodia. Dendritic-like cells were flat and presented extensive prolongations, making several contacts with small rounded cells, while fusiform cells presented their surfaces dominated by microvilli. We believe that the knowledge about NG97 cell line may be useful for a deeper understanding of biological and immunological characteristics of gliomas Cancer Cell International 5: 13, 2005. URL: http://www.cancerci.com/content/5/1/13 *E-mail: wirlatam@unicamp.br
P124-05 Plasmodium falciparum rhoptry protein RSP2 triggers destruction of the erythroid lineage Layez C, Nogueira P, Combes V, Costa FTM*, Juhan-Vague I, Pereira da Silva LH, Gysin J Infecções por Plasmodium falciparum, atualmente contabilizadas em mais de 300 milhões de casos anualmente, podem evoluir para casos de anemia severa, entretanto a porcentagem de hemácias infectadas não corresponde diretamente a grau de anemia. Neste artigo os autores mostram pela primeira vez que a existência de deposição da proteína de superfície de formas de anel-2 (RSP-2) de Plasmodium falciparum em células eritróides precursoras coletadas da medula óssea de pacientes com infecção malárica. Anticorpos monoclonais contra esta proteína se mostraram capazes de aumentar fagocitose e ativação do complemento in vitro. Estas observações revelam um novo mecanismo parasitário implicado na destruição de hemácias sadias e suas precursoras, sugerindo sua participação na anemia severa causada por malária falciparum. Blood 106: 3632-3638, 2005. IF = 10.131 * E-mail: costaftm@unicamp.br
P125-05 Immunophenotypic and ultrastructural validation of a new human glioblastoma cell line Schenka AA, Machado CML, Grippo MC, Queiroz LS, Schenka NGM, Chagas CA, Verinaud L*, Brousset P, Vassallo J The purpose of this study is to characterize the immunophenotype and ultrastructural aspects of a human glioma cell line, NG97 established by Grippo et al. in 2001, using both the cultured cells and the nude mouse growth, in order to assess its glial nature and possible divergent differentiations. NG97 cells expressed the main neuroglial markers (GFAP, S-100 protein, NSE and Leu-7) and showed no aberrant expression of other histogenetic markers. Proof of glial nature was further provided by the xenotransplant’s ultrastructural features which were consistent with glioblastoma. No significant immunophenotypic or ultrastructural differences between the two morphologically distinct populations were found. In conclusion, NG97 cells constitute a pure glial-committed cell line, which may prove useful as a malignant glioma model in studies addressing pathophysiological, diagnostic and therapeutic issues. Cellular and Molecular Neurobiology 25: 929-941, 2005. IF = 2.022 * E-mail: verinaud@unicamp.br
P126-05 Adhesion properties, fimbrial expression and PCR detection of adhesin-relate genes of avian Escherichia coli strains De Campos TA, Stheling EG, Ferreira A, Pestana de Castro AF, Brocchi M, Silveira WD* Veterinary Microbiology 106: 275-278, 2005. IF = 2.175 * E-mail: wds@unicamp.br
P127-05 Controle biológico bacteriano e tratamento de efluentes através do uso de bacteriófagos dos Reis MR, Teixeira EP, Silveira WD* Revista Biotecnologia, Ciência e Desenvolvimento 33: 26-28, 2005. * E. mail: wds@unicamp.br
P128-05 Swine and poultry pathogens: the complete genome sequences of two strains of Mycoplasma hyopneumoniae and a strain of Mycoplasma synoviae Vasconcelos ATR, Ferreira HB, Bizarro CV, Bonatto SL, Carvalho MO, Pinto PM, Almeida DF, Almeida LGP, Almeida R, Alves Jr L, Assunção EM, Azevedo VAC, Bogo MR, Brigido MM, Brocchi M*, Burity HÁ, Camargo AA, Camargo SS, Crespo MS Zaha A. Journal of Bacteriology 187: 5568-5577, 2005. IF = 4.167 * E.mail: mbrocchi@unicamp.br
P129-05 Use of blends of bioabsorbable poly(L-lactic acid)/poly(hydroxybutyrate-co-hydroxyvalerate) as surfaces of Vero cell culture Santos AR, Ferreira BMP, Duek EAR, Dolder H*, Wada MLF Brazilian Journal of Medical and Biological Research 38: 1623-1632, 2005. IF = 0.859 *E-mail: heidi@unicamp.br
P130-05 Spermatogenesis of Melipona quadrifasciata anthidioides (Hymenoptera: Apidae): fate of the atypical spermatids Monica C, Lino Neto J, Dolder H* Caryologia 58: 183-188, 2005. IF = 0.295 *E-mail: heidi@unicamp.br
P131-05 Ultrastructural characterization of spermatozoa in euglossine bees (Hymenoptera, Apidae, Apinae) Zama U, Lino Neto J, Mello SM, Campos LAO, Dolder H* Insectes Sociaux 52: 122-131, 2005. IF = 1.618 *E-mail: heidi@unicamp.br
P132-05 Immunocytochemical localization of tubulins in spermatids and spermatozoa of Euptoieta hegesia (Lepidoptera: Nymphalidae) Mancini K, Bao SN, Fernandes AP, Dolder H* Tissue & Cell 37: 81-89, 2005. IF = 1.132 *E-mail: heidi@unicamp.br
P133-05 Peroxidase-based biosensor as a tool for a fast evaluation of antioxidant capacity of tea Mello LD, Alves AA, Macedo DV*, Kubota LT* Food Chemistry 92: 515-519, 2005. IF = 1.811 *E-mail: kubota@iqm.unicamp.br
P134-05 Use of partly inbred S-3 lines for the development of maize single-crosses Chavez A, De Souza CL, De Souza AP* Maydica 50: 113-121, 2005. IF = 0.247 *E-mail: anete@unicamp.br
P135-05 Tropical maize germplasm: what can we say about its genetic diversity in the light of molecular markers? Laborda PR, Oliveira KM, Garcia AAF, Paterniani MEA, de Souza AP* Theoretical and Applied Genetics 111: 1288-1299, 2005. IF = 3.063 *E-mail: anete@unicamp.br
P136-05 Spatial distribution and microhabitat preference of Psecas chapoda (Peckham & Peckham)(Araneae, Salticidae) Romero GQ, Vasconcellos-Neto J* Journal of Arachnology 33: 124-134, 2005. IF = 0.557 *E-mail: jvascont@unicamp.br
P137-05 Testing the functions of detritus stabilimenta in webs of Cyclosa fillineata and Cyclosa morretes (Araneae: Araneidae): Do they attract prey or reduce the risk of predation? Gonzaga MO, Vasconcellos-Neto J* Ethology 111: 479-491, 2005. IF = 1.621 *E-mail: jvascont@unicamp.br
P138-05 The effects of the wood-boring Oncideres humeralis (Coleoptera, Cerambycidae) on the number and size structure of its host-plants in south-east-Brazil Romero GQ, Vasconcellos-Neto J*, Neto HFP Journal of Tropical Ecology 21: 233-236, 2005. IF = 1.013 *E-mail: jvascont@unicamp.br
P139-05 The effects of plant structure of the spatial and microspatial distribution of a bromeliad-living jumping spider (Saticidae) Romero GQ, Vasconcellos-Neto J* Journal of Animal Ecology 74: 12-21, 2005. IF = 3.399 *E-mail: jvascont@unicamp.br
P140-05 Two new species of Symplocos Jacq. (Symplocaceae) from Minas Gerais, Brazil Aranha-Filho JLM, Fritsch PW, Almeda F, Martins AB* Proceedings of the California Academy of Sciences 56:295-303, 2005. *E-mail: amartins@unicamp.br
P141-05 Herbivoria foliar em Chrysophyllum gonocarpum (Sapotaceae) no Parque Estadual Mata dos Godoy, Londrina, Estado do Paraná, Brasil. Bianchini E, Santos FAM* Acta Scientiarum 27: 285-290, 2005. *E-mail: fsantos@unicamp.br
P142-05 Late-acting self-incompatibility and other breeding systems in Tabebuia (Bignoniaceae) Bittencourt Jr NS, Semir J* International Journal of Plant Sciences 166: 493-506, 2005. IF = 1.950 *E-mail: semir@unicamp.br
P143-05 Ontogeny and structure of the pericarp and seed coat of Lithraea molleoides Vell. Engl. (Anacardiaceae) with taxonomic notes Carmello-Guerreiro SM*, Paoli AAS Brazilian Archives of Biology and Technology 48: 599-610, 2005. IF = 0.131 *E-mail: smcg@unicamp.br
P144-05 Abundância de ramos reprodutivos e produção de sementes em populações de Ipomoea pes-caprae (L.) R. Br. na Ilha de Santa Catarina, Brasil Castellani TT, Santos FAM* As variações na proporção de ramos reprodutivos e na produção de frutos e sementes de Ipomoea pes-caprae (Convolvulaceae) foram avaliadas em dez praias da Ilha de Santa Catarina, SC. As manchas tinham cerca de 14 m, 9,6 ramos/m2 e 39% de ramos reprodutivos. A proporção de ramos reprodutivos variou entre os ciclos. A produção de frutos nas manchas atingiu valores de 40 frutos/m2 e 140 sementes/m2. As populações com maior produção de sementes localizaram-se em áreas adjacentes a amplas planícies costeiras, podendo representar fontes potenciais de sementes para as áreas de baixa produção na ilha. Acta Botanica Brasilica 19: 251-264, 2005. *E-mail: fsantos@unicamp.br
P145-05 Structure, distribution of species and inundation in a riparian forest of Rio Paraguai, Pantanal, Brazil Damasceno Jr GA, Semir J, Santos FAM*, Leitão Filho HF Um total de 695 indivíduos com CAP > 1,3m de 37 espécies, 35 gêneros e 23 famílias foram amostrados em 108 parcelas de 10X10m em uma floresta ripária no rio Paraguai, MS. A distribuição das espécies foi correlacionada com a duração sazonal da cheia entre 1974 e 1995. A diversidade de espécies (índice de Shannon) foi de 2,7. O maior VI foi obtido para Inga vera, seguido por Triplaris gardneriana, Ocotea diospyrifolia, Crataeva tapia e Vochysia divergens. As espécies foram agrupadas de acordo com a duração da cheia e as parcelas de acordo com a distância da margem do rio. Flora 200: 119-135, 2005. IF = 1.086 *E-mail: fsantos@unicamp.br
P146-05 A new species of Crotalaria L. (Leguminosae-Papilionoideae) from Southeastern Brazil Flores AZ, Tozzi AMGA* Novon 14: 418-420, 2005. IF = 0.158 *E-mail: anatozzi@unicamp.br
P147-05 Duas novas espécies de Myrsine (Myrsinaceae) para o Brasil Freitas MF, Kinoshita LS* Rodriguesia 56: 67-72, 2005. *E-mail: luizakin@unicamp.br
P148-05 Programa BIOTA/FAPESP: um modelo brasileiro para programas de pesquisa em conservação e uso sustentável da biodiversidade. Joly CA*, Speglich E Boletin de la Sociedad Argentina de Botanica 39: 303-306, 2005. *E-mail: cjoly@unicamp.br
P149-05 Xanthones from Weddelina squamulosa Tul. (Podostemaceae). Kato L, Oliveira CM, Bittrich V, Amaral MCE* Xantonas foram investigadas em Weddelina squamulosa Tul. A presença destes compostos relativamente raros entre as angiospermas corrobora a proximidade filogenética entre Podostemaceae e Clusiaceae. Biochemical Systematics and Ecology 33: 331-334, 2005. IF = 0.827 *E-mail: volker@unicamp.br
P150-05 Flora da Serra do Cipó: Apocynaceae s. str. Kinoshita LS*, Simões AO Boletim de Botânica USP 23: 235-256, 2005. *E-mail: luizakin@unicamp.br
P151-05 Relação entre o solo e remanescentes da vegetação natural do município de Ribeirão Preto/SP Kotchetkoff-Henriques O, Joly CA*, Bernacci LC Visando o estabelecimento da relação entre as características do solo e a composição florística, foi efetuado levantamento florístico em 95 fragmentos de vegetação natural em Ribeirão Preto. Foram registradas 509 espécies arbóreas pertencentes a 71 famílias botânicas. Uma análise de correspondência retificada (DCA) e uma análise de agrupamentos utilizando a distância relativa de Sørensen indicaram a existência de três grupos florísticos, associados aos tipos de solos. Um grupo maior associado aos solos derivados do basalto, Latossolo Roxo e Litossolo, pôde ser subdividido em dois subgrupos de acordo com o grau de decomposição da rocha, identificados como mata mesófila e mata decídua, respectivamente. Outros dois grupos foram identificados, um associado ao Latossolo Vermelho Escuro e Vermelho Amarelo, cerradão, e outro ao solo Hidromórfico, mata paludícola. Cada grupo apresentou uma composição florística característica. Considerando as espécies arbóreas mais comuns, cerca de 65% tendem a ocorrer de forma diferenciada entre os tipos de solos. A associação observada entre o solo e a composição florística dos remanescentes poderá contribuir para o estabelecimento de critérios para conservação dos fragmentos de vegetação, bem como na indicação das espécies apropriadas para plantio nos projetos de recomposição da vegetação em diferentes regiões da cidade. Revista Brasileira de Botânica 28: 541-562, 2005. *E-mail: cjoly@unicamp.br
P152-05 Swartziarboreol diterpenes from Swartzia langsdorffii Raddi (Notes) Magalhães AF, Tozzi AMGA*, Santos CC, Magalhães EG Journal of Natural Products 68: 1290-1292, 2005. IF = 2.267 http://pubs.acs.org/journals/jnprdf/index.html *E-mail: anatozzi@unicamp.br
P153-05 Floral scent of Eleocharis elegans (Kunth) Roem. & Schult. (Cyperaceae). Magalhães AF, Ruiz ALTG, Flach A, Faria AD, Magalhães EG, Amaral MCE* A possível presença de voláteis foi investigada em inflorescências de Eleocharis elegans e E. sellowiana através de headspace dinâmico. Voláteis não foram detectados nas inflorescências inconspícuas de E. sellowiana, mas diversos voláteis florais foram produzidos pelas inflorescências vistosas de E. elegans. Os resultados são discutidos em um contexto ecológico e filogenético. Biochemical Systematics and Ecology 33:675-679, 2005. IF = 0.827 *E-mail: volker@unicamp.br
P154-05 Melastomataceae nas formações campestres do município de Carrancas, Minas Gerais Matsumoto K, Martins AB* Hoehnea 32: 389-420, 2005. *E-mail: amartins@unicamp.br
P155-05 Flora e estrutura do estrato lenhoso numa comunidade de Cerrado em Santo Antônio do Leverger, MT, Brasil Nogueira Borges HB, Shepherd GJ* Revista Brasileira de Botânica 28: 67-74, 2005. *E-mail: george@unicamp.br
P156-05 Juvenile dynamics of the endemic and rare Enterolobium glaziovii (Mimosaceae) around reproductive trees in the Atlantic Forest, Brazil Ramos FN, Mattos DMS, Santos FAM* Revista Brasileira de Botânica 28: 765-772, 2005. *E-mail: fsantos@unicamp.br
P157-05 Spatial distribution of seeds and juveniles of the endemic and rare Enterolobium glaziovii (Mimosaceae) around reproductive trees in the Atlantic forest, Brazil Ramos FN, Mattos DMS, Santos FAM* A distribuição espacial de frutos e juvenis de Enterolobium glaziovii (Leguminosae) foi avaliada em 4 parcelas circulares de 30m de raio, centralizadas em uma árvore reprodutiva para determinar se o tamanho das copas, topografia e cobertura do dossel influenciam o padrão. Apesar de um maior número de frutos debaixo da copa, não houve diferença no número de juvenis sob e fora da copa. O número de frutos e juvenis esteve corelacionado à área das copas. A maioria deles encontrava-se em terrenos inclinados. Os resultados indicam que essas variáveis afetam a distribuição espacial e possivelmente a dinâmica dessa espécie. Acta Botanica Brasilica 19: 609-614, 2005. *E-mail: fsantos@unicamp.br
P158-05 Phenology of Psychotria tenuinervis (Rubiaceae) in Atlantic Forest fragments: regional and local scale Ramos FN, Santos FAM* Canadian Journal of Botany-Revue Canadienne de Botanique 83: 1305-1316, 2005. IF = 1.058 *E-mail: fsantos@unicamp.br
P159-05 O gênero Prestonia R.Br. nom. cons. (Apocynoideae, Apocynaceae) no Sul e Sudeste do Brasil Rio MCS, Kinoshita LS* Hoehnea 32: 1-26, 2005. *E-mail: luizakin@unicamp.br
P160-05 Anatomia foliar como subsídio para a taxonomia de espécies de Forsteronia G.Mey (Apocynaceae) dos cerrados paulistas. Rio MCS, Kinoshita LS, Castro MM* Revista Brasileira de Botânica 28: 713-726, 2005. *E-mail: mariliac@unicamp.br
P161-05 Espécies de Vanhouttea Lem. e Sinningia Nees (Gesneriaceae) polinizadas por beija-flores: interações relacionadas ao habitat da planta e ao néctar Sanmartin Gajardo I, Sazima M* Revista Brasileira de Botânica 28: 441-450, 2005. *E-mail: masazima@unicamp.br
P162-05 New species of Calibrachoa and Petunia (Solanaceae) Semir J*, Stehmann JR Systematic Botany Monographs: 341-348, 2005. *E-mail: semir@unicamp.br
P163-05 Spatial variation and dynamics of flooding, canopy openness, and structure in a Neotropical swamp forest Souza AF, Martins FR* We investigated temporal changes and spatial variation of soil drainage and understory light availability in 2001 and 2002, and small stem (5 dbh 10 cm) density, forest successional phase and large stem (dbh 10 cm) spatial distribution in one ha of tropical swamp forest in SE Brazil. Large trees aggregated at scales larger than 40 m, while arborescent palms were aggregated at all scales. Our findings suggest that tropical swamp forests represent highly heterogeneous environments, which are not adequately described by the gap/non-gap dichotomy. Plant Ecology 180:161-173, 2005. IF = 1.011 *E-mail: fmartins@unicamp.br
P164-05 A new species of Mucuna Adans. (Leguminosae, Papilionoideae, Phaseoleae) from Southeastern Brazil, with a key to Brazilian species Tozzi AMGA, Agostini K, Sazima M* Taxon 54: 451-455, 2005. IF = 2.239 *E-mail: msazima@unicamp.br
P165-05 Sinopse de Bauhinia sect. Pauletia (Cav.) DC. (Leguminosae: Caesalpinioideae: Cercideae) no Brasil Vaz AMSF, Tozzi AMGA* Revista Brasileira de Botânica 28: 477-491, 2005. *E-mail: anatozzi@unicamp.br
P166-05 Florística dos componentes arbóreo e arbustivo de um trecho da Floresta Estacional Semidecídua Montana, município de Pedreira, estado de São Paulo. Yamamoto LF*, Kinoshita LS, Martins FR Visando conhecer a flora de árvores e arbustos em um fragmento da Floresta Estacional Semidecídua Montana e verificar se há diferença entre as formações Montana e Submontana no estado de São Paulo, fizemos coletas semanais durante 15 meses na Fazenda Bela Vista (46º52' W e 22º47' S, 750-850m de altitude). Identificamos 151 espécies, 106 gêneros e 47 famílias de angiospermas. Através de análises estatísticas, concluímos que as formações Montana e Submontana da Floresta Estacional Semidecídua do estado de São Paulo são distintas quanto à composição de espécies, gêneros e famílias. Revista Brasileira de Botânica 28: 191-202, 2005. *E-mail: kikyo@unicamp.br
P167-05 Influências ambientais no rendimento intrínseco do café Pezzopane CG, Medina Filho HP, Bordignon R, Siqueira WJ, Mazzafera P* Bragantia 64: 39-50, 2005 *E-mail: pmazza@unicamp.br
P168-05 Biochemical changes during the development of witches’ broom: the most important disease of cocoa in Brazil caused by Crinipellis perniciosa Scarpari LM, Meinhardt LW, Mazzafera P, Pomella AWv, Schiavinato MA, Cascardo JCM, Pereira GAG Journal of Experimental Botany 56: 865-877, 2005. IF = 3.336 *E-mail: goncalo@unicamp.br
P169-05 Effect of water and temperature stress on the content of active constituents of Hypericum brasiliense Choisy Abreu IN, Mazzafera P* Plant Physiology and Biochemistry 43: 241-248, 2005. IF = 1.556 *E-mail: pmazza@unicamp.br
P170-05 The influence of irrigation and edapho-climatic conditions on the chemical composition and beverage quality of coffee Silva EA, Mazzafera P*, Brunini O, Sakai E, Arruda FB, Mattoso LHC, Carvalho CRL, Pires RCM Brazilian Journal of Plant Physiology 17: 229-238, 2005. *E-mail: pmazza@unicamp.br
P171-05 Production of pilocarpine in callus of Jaborandi (Pilocarpus microphyllus Stapf) Abreu IN, Sawaya ACHF, Eberlin MN, Mazzafera P* In Vitro Cellular & Developmental Biology-Plant 41: 806-811, 2005. IF = 0.660 *E-mail: pmazza@unicamp.br
P172-05 Seed removal by ants from faeces produced by different vertebrate species Pizo MA, Guimarães Jr PR, Oliveira PS* Ants commonly harvest seeds from faeces of frugivores, and may influence seed dispersal success of plants. Seed removal by ants from vertebrate faeces is influenced by the seed species involved. In this study experimental seed-containing faecal portions were prepared using defecations of birds, marsupials, and monkeys, and seeds of two aroids (Philodendron corcovadense and P. appendiculatum, Araceae) and one liana species (Schlegelia parviflora, Bignoniaceae). Faecal portions were arranged along a transect established in the understory of a lowland rainforest in SE Brazil. Seed species and type of faeces affected the proportion of seeds removed, whereas the interaction between them had no significant effect. The results indicate that seed species affects seed removal by ants, while the type of faeces probably interacts with seed traits to influence faeces detection. Ecoscience 12:136-140, 2005. IF = 1.261 *E-mail: pso@unicamp.br
P173-05 Does predation by shell-breaking crabs on gastropods influence shell use by hermit crabs? Turra A, Denadai MR, Leite FPP Predation is an important factor in organizing communities and in influencing Shell avaliability to hermit crabs. This study focuses on how reliable would be this effect. Variable rates of predation within and among crabs species were recorded .The number of individuals of gastropod consumed showed to be more dependent on crab size than on crab species. Different crab species employed different predatory strategies. Crushing was generally lethal and used generally to prey upon relatively smaller preys while peeling attempt yielded higher survival rates. Peeling made shells available to medium and large sized individuals while crushing produced shells to both medium and small sized hermit crabs. The selection experiments indicate species preference pattern, explained by the higher energetic value of the snail in relation to the hermit crab and also showed a high variation within and between predator species. The predation tactic was also dependent on prey size Marine Ecology-Progress Series 286: 279-291, 2005. IF = 2.315 *E-mail: fosca@unicamp.br
P174-05 Meiotic analysis of two putative polyploid species of Verbenaceae from Brazil Brandão AD, Viccini LF, Recco-Pimentel SM* The natural occurrence of hybrids and polyploids hinders the precise identification of some taxa in Verbenaceae (Lamiales). Since meiotic studies are useful for understanding the chromosomal behavior of plant species, we have examined the meiotic stages and chromosomal behavior of Lippia alba (Mill) N. E. Brown and Lantana camara Plum. in Brazil. Fifteen and 22 bivalents were observed during diplotene and diakinesis in L. alba and L. camara, respectively. The chromosomes segregated normally during anaphase I, telophase I and II. The regular meiotic behavior seen in L. alba and L. camara indicated that polyploidy was established by a diploid-like behavior in meiosis, although this did not exclude a possible diploid origin.Caryologia 58: 315-319, 2005. IF = 0.295 E-mail: shirlei@unicamp.br
P175-05 Gastroprotective activity of Pradosia huberi on experimentally induced gastric lesions in rodents: Role of endogenous sulphydryls and nitric oxide Kushima H, Hiruma-Lima CA, Santos MAE, Viana, Coelho-Ferreira M, Souza Brito ARM* Pradosia huberi is a medicinal plant very common in the Amazonian forest and with a potential medicinal value in gastritis and gastric ulcer mentioned by local folk medicine. We evaluated the acute toxicity and antiulcerogenic effect of a hydroalcoholic extract (HAE) obtained from Pradosia huberi barks in rodents. No acute toxicological sign or symptom was observed in animals treated with the highest dose (5000 mg/kg, p.o.) of P. huberi. In the HCl/EtOH-induced gastric ulcer model, HAE demonstrated significant inhibition of the ulcerative lesion index by 73% and 88%, in relation to the control value. The gastric damage induced by absolute ethanol in rats was effectively reduced by 84, 88 and 81% when compared with the control. In the NSAID-induced lesion model, HAE also showed antiulcerogenic effect with decrease in gastric lesions of 56% and 67 % when compared with animals treated with vehicle. In the gastric ulcer induced by pylorus ligature model, the administration of HAE by oral and intraduodenal routes inhibited the gastric lesion index by 79 and 52%, respectively. The treatment with HAE (p.o.) significantly increased gastric volume, the pH values and promoted reduced acid output. By comparative effect (intraduodenal and oral route), we observed that HAE was better for local activity in gastric mucosa than in systemic action. HAE also has a non-specific activity when found to be the inhibitor of intestinal motility. The mechanism of action of HAE did not seem to be related to the NO-inhibitor but showed participation of endogenous sulphydryl group in the gastroprotective action. Journal of Ethnopharmacology 101: 61-67, 2005. IF = 1.554 *E-mail: abrito@unicamp.br
P176-05 Application of liquid chromatography/electrospray ionization tandem mass spectrometry to the analysis of polyphenolic compounds from an infusion of Byrsonima crassa Niedenzu Sannomiya M, Montoro P, Piacente S, Pizza C, Brito ARMS*, Vilegas W A fast and reliable method, based on high-performance liquid chromatography coupled to electrospray ionization ion trap tandem mass spectrometry (HPLC/ESI-ITMS), was developed to investigate the infusion prepared from the leaves of Byrsonima crassa Niedenzu, a native plant used in Brazil against gastric disorders. The method allowed separation of three major classes of compounds and identification of over 20 very polar compounds characterized as galloylquinic acids, proanthocyanidins, and flavonoid glycosides, and the dimeric flavonoid amentoflavone and minor amounts of galloyl hexose and galloyl saccharose. This approach provided data that will allow establishment of a method for a future standardization of the infusion. Rapid Communications in Mass Spectrometry 19: 2244-2250, 2005. IF = 3.087 *E-mail: abrito@unicamp.br
P177-05 Preliminary studies of Mammea americana L. (Guttiferae) bark/latex extract point to an effective antiulcer effect on gastric ulcer models in mice Toma W, Hiruma-Lima CA, Guerrero RO, Brito ARMS* Mammea americana L. fruit is very common in the diet of the population of northern South America and has a potential medicinal value as a tonic and against stomachache, as used in folk medicine. We evaluated ethanolic/EtOH, methanolic/MeOH and dichloromethane/DCM extracts obtained from M. americana, for their ability to protect the gastric mucosa against injuries caused by necrotizing agents (0.3 M HCI/60% EtOH), hypothermic restraint stress, nonsteroidal anti-inflammatory drugs (NSAID, indomethacin) and pylorus ligation. The results suggest that EtOH and DCM extracts obtained from M. americana possess excellent antisecretory and/or gastrotective effect in all gastric ulcer models. The antiulcerogenic compound(s) present in M. americana are suggested to be clustered in the apolar fraction. Phytomedicine 12: 345-350, 2005. IF = 1.348 *E-mail: abrito@unicamp.br
P178-05 Trypanocidal activity of 2-propen-1-amine derivatives on trypomastigotes culture and in animal model Oliveira DA, Pereira DGA, Fernandes MAP, De Castro SL, Souza Brito ARM*, De Souza AO, Duran N The cis and trans isomers of the unsubstituted and bromo-2-propen-1-amine derivatives were evaluated in vitro on T. cruzi. The results showed that cis is the most active isomeric form against trypomastigote forms, indicating that it may contribute most to the trypanocidal effect. All mice which received 5 mg kg–1 daily for 9 consecutive days, or 200 mg kg–1 in a single dose of the bromo derivative of 2-propen-1-amine, survived after an infection with 104 trypomastigotes/ml of the Y-strain of T. cruzi. They also had a significantly lower parasitemia than the controls. Chromatographic analyses of the lipid extracts obtained from parasites treated with 2-propen-1-amine derivatives and controls (not treated) revealed that growth inhibition is correlated with the accumulation of squalene and the decrease of ergosterol levels. These results suggest that inhibition of the biosynthesis of ergosterol is an important target for the action of the 2-propen-1-amine derivative on T. cruzi through the inhibition of the enzyme squalene epoxidase. Parasitology Research 95:161 – 166, 2005. IF = 1.226 *E-mail: abrito@unicamp.br
P179-05 Is gastric ulceration different in normal and malnourished rats? Paula ACB, Gracioso JS, Toma W, Bezerra R, Saad MAJ, De Lucca IMS, Carneiro EM, Brito ARMS* We tested the hypothesis that protein deprivation influences gastric ulcer formation, as well as metabolism and organ growth, in rats. In the present study, there was a significant reduction in the body and organ weight of rats fed a low-protein diet. Malnourished rats were less susceptible to ulceration of the gastric mucosa in ethanol and indomethacin models of acute gastric ulcers when compared with rats fed a normoproteic diet (17% protein). Pylorus ligature altered gastric juice composition (increased pH and gastric volume, and decreased total acid concentration) in the animal group fed a low-protein diet compared with the group fed a diet containing 17 % protein. The gastric mucosa was more damaged in malnourished rats than in normal rats evaluated for 14 d after acetic acid injection. Malnourished rats exhibited resistance to acute gastric lesions, owing to an increase in prostaglandin GE(2) release and mucus secretion, which protected their gastric mucosa. This phenomenon was not seen in subchronic gastric ulceration. British Journal of Nutrition 93: 47-52, 2005. IF = 2.967 *E-mail: abrito@unicamp.br
P180-05 Flavonoids and antiulcerogenic activity from Byrsonima crassa leaves extracts Sannomiya M, Fonseca VB, da Silva MA, Rocha LRM, dos Santos LC, Hiruma-Lima CA, Brito ARMS*, Vilegas W We evaluated the potential antiulcerogenic effect of extracts obtained from the leaves of B. crassa namely hydromethanolic (80% MeOH), methanolic (MeOH) and chloroformic extracts (CHCl3). The oral administration (250, 500 and 1000 mg/kg) of all the extracts reduced the formation of lesions associated with HCl/ethanol administration in mice. Phytochemical investigation of B. crassa afforded quercetin-3-O-beta-D-galactopyranoside, quercetin-3-O-alpha-L-arabinopyranoside, the biflavonoid amentoflavone, (+)-catechin and (-)-epicatechin which may explain the antiulcerogenic effect of the extracts of B. crassa leaves. Journal of Ethnopharmacology 97: 1-6, 2005. IF = 1.554 *E-mail: abrito@unicamp.br
P181-05 Evaluation of Strychnos pseudoquina ST. HIL. leaves extract on gastrointestinal activity in mice da Silva MA, Rafacho BP, Hiruma-Lima CA, da Rocha LR, dos Santos LC, Sannomiya M, Souza-Brito AR*, Vilegas W Strychnos pseudoquina St. Hil. (Loganiaceae) was investigated for its ability to protect the gastric mucosa against injuries caused by non-steroidal anti-inflammatory drugs (piroxicam) and a necrotizing agent (HCl/EtOH) in mice. The MeOH extract and an enriched alkaloidic fraction provided significant protection in experimental models wheer used at doses of 250 and 1000 mg/kg. In vivo tests were carried out to evaluate for possible toxic effects and no mortality was observed up to the 5 g/kg dose level. Phytochemical investigation led to the isolation of a new indole alkaloid, which elucidated the observed pharmacological effects. Chemical and Pharmaceutical Bulletin (Tokyo) 53: 881-885, 2005. IF = 1.246 *E-mail: abrito@unicamp.br
P182-05 Early effects of estrogen on the rat ventral prostate Garcia-Florez M, Oliveira CA, Carvalho HF* Complex interactions between androgen and estrogen (E2) regulate prostatic development and physiology. We analyzed the early effects of a high single dose of E2 (25 mg/kg body weight) and castration (separately or combined) on the adult 90-day-old male Wistar rat ventral prostate. Castration and exogenous E2 markedly reduced ventral prostate weight, with a significant reduction in the epithelial compartment and increased stroma. The final volume of the epithelium was identical at day 7 for all treatments. E2 had an immediate effect, causing a reduction in epithelial volume as early as day 1. An increase in smooth muscle cell volume resulted from the concentration of these cells around the regressing epithelium. The treatments resulted in differential kinetics in epithelial cell apoptosis. Castration led to a peak in apoptosis at day 3, with 5% of the epithelial cells presenting signs of apoptosis, whereas E2 caused an immediate increase (observed on day 1) and a sustained (up to day 7) effect. E2 administration to castrated rats significantly increased the level of apoptosis by day 3, reaching 9% of the epithelial cells. The divergent kinetics between treatments resulted in the same levels of epithelial regression after 7 days. These results show that E2 has an immediate and possibly direct effect on the prostate, and anticipates epithelial cell death before reducing testosterone to levels as low as those of castrated rats. In addition, E2 and androgen deprivation apparently cause epithelial cell death by distinct and independent pathways. Brazilian Journal of Medical and Biological Research 38: 487-497, 2005. IF = 0.859 *E-mail: hern@unicamp.br
P183-05 Modulation of smooth muscle cell function: morphological evidence for a contractile to synthetic transition in the rat ventral prostate after castration Vilamaior PS,Taboga SR,Carvalho HF* We evaluated the involvement of rat ventral prostate smooth muscle cells (SMC) in secretory activity and whether this function is modulated after castration. Cell morphology was examined at both light and electron microscopy levels and the organelles involved in secretory function were labeled by the zinc-iodide-osmium (ZIO) method at the ultrastructural level and their volume density was determined by stereology. Castration resulted in marked changes of the SMC, which adopted a spinous aspect and abandoned the layered arrangement observed in the prostates of non-castrated rats. The volume density of ZIO reactive organelles increased progressively after castration, reaching significantly higher levels 21 days after castration. Since previous studies have demonstrated that SMC express SMC markers and are able to respond to adrenergic stimulation, we concluded that differentiated SMC are able to shift from a predominantly contractile to a more synthetic phenotype without changing their differentiation status. Cell Biology International 29: 809-816, 2005. IF = 1.194 *E-mail: hern@unicamp.br
P184-05 Tissue remodeling in Guinea pig lateral prostate at different ages after estradiol treatment Scarano WR, Cordeiro RS, Goes RM, Carvalho HF*, Taboga SR Estrogen seems to have an essential role in the fibromuscular growth characteristic of benign prostatic hyperplasia (BPH). We described the effects of chronic estradiol treatment on Guinea pig prostatic stroma at different ages. Marked fibromuscular hypertrophy was observed after estradiol treatment in animals of pre-pubertal and adult ages. Increases in the density and thickness of the collagen and elastic fibers were observed by histochemistry. Transmission electron microscopy revealed wide distributions of collagen fibrils and large elastic fibers adjacent to the epithelial basal lamina and between the stromal cells, establishing contacts between them. The results indicate that the Guinea pig prostate simulates the stromal modifications observed in BPH in some aged animals after estrogen treatment at different ages, making it a good model for this disease. Cell Biology International 29: 778-784, 2005. IF = 1.194 *E-mail: hern@unicamp.br
P185-05 The prima donna of epigenetics: the regulation of gene expression by DNA methylation Santos KF, Mazzola TN, Carvalho HF* This review focuses on the mechanisms of DNA methylation, DNA methylation pattern formation and their involvement in gene regulation. Association of DNA methylation with imprinting, embryonic development and human diseases is discussed. Furthermore, besides considering changes in DNA methylation as mechanisms of disease, the role of epigenetics in general and DNA methylation in particular in transgenerational carcinogenesis, in memory formation and behavior establishment are brought about as mechanisms based on the cellular memory of gene expression patterns. Brazilian Journal of Medical and Biological Research 38:1531-1541, 2005. IF = 0.859 *E-mail: hern@unicamp.br
P186-05 Differential effects of uncharged aminoamide local anesthetics on phospholipids bilayers, as monitored by H-1-NMR measurements Fraceto LF, Spisni A, Schreier S, de Paula E* Biophysical Chemistry 115: 11-18, 2005. IF = 1.925 *E-mail: depaula@unicamp.br
P187-05 Physico-chemical characterization of benzocaine-beta-cyclodextrin inclusion complexes Pinto LMA, Fraceto LF, Santana MHA, Pertinhez TA, Junior SA, de Paula E* Journal of Pharmaceutical and Biomedical Analysis 39: 956-963, 2005. IF = 1.889 *E-mail: depaula@unicamp.br
P188-05 Tendency for oxidation of annelid hemoglobin at alkaline pH and dissociated states probed by redox titration Bispo JAC, Landini GF, Santos JLR, Norberto RN, Bonafé CFS* Comparative Biochemistry and Physiology B-Biochemistry & Molecular Biology 141: 498-504, 2005. IF = 1.404 *E-mail: bonafe@unicamp.br
P189-05 Coagulation and cancer therapy: the potential of natural compounds Justo GZ, Ferreira CV* Current Genomics 6: 461-469, 2005. *E-mail: carmenv@unicamp.br
P190-05 RNA-based gene therapy for haemophilia B Peppelenbosch MP, Milano F, Ferreira CV*, Knapinska A, Diks SH, Spek CA Current Genomics 6: 401-404, 2005. *E-mail: carmenv@unicamp.br
P191-05 Violacein cytotoxicity on human blood lymphocytes and effect on phosphatases Bromberg N, Justo GZ, Háun M, Duran N, Ferreira CV* Journal of Enzyme Inhibition and Medicinal Chemistry 20: 449-454, 2005. IF = 1.667 *E-mail: carmenv@unicamp.br
P192-05 Riboflavin: a multifunctional vitamin De Souza ACS, Ferreira CV, Juca MB, Aoyama H*, Cabagis ADM, Pepplenbosch MP Química Nova 28: 887-891, 2005. IF = 0.650 *E-mail: aoyama@unicamp.br
P193-05 Cadmium chloride-induced oxidative stress in skeletal muscle cells in vitro Yano CL, Marcondes MCCG* Free Radical Biology and Medicine 39: 1378-1384, 2005. IF = 4.971 *E-mail: cintgoma@unicamp.br
P194-05 Evidence for two atypical conformations of beta-adrenoceptors and their interaction with Gi proteins Santos IN, Sumitame M, Caceres VA, Moreira MF, Krieger MH*, Spadari-Bratfisch RC European Journal of Pharmacology 513: 109-118, 2005. IF = 2.477 *E-mail: kriegerm@unicamp.br
P195-05 High frequency of Fredrickson’s phenotypes IV and IIb in Brazilians infected by human immunodeficiency virus Albuquerque EMV, Faria EC, Oliveira HCF*, Magro DO, Castilho LN BMC Infectious Diseases 5: art.no. 47, 2005. IF = 1.956 *E-mail: ho98@unicamp.br
P196-05 Atherosclerosis in aged mice over-expressing the reverse cholesterol transport genes Berti JA, Faria EC, Oliveira HCF* Brazilian Journal of Medical and Biological Research 38: 391-398, 2005. IF = 0.859 *E-mail: ho98@unicamp.br
P197-05 Identification and genomic characterization of a new virus (Tymoviridae family) associated with citrus sudden death disease Maccheroni W + 20 authors, Arruda P*, + 4 authors Journal of Virology 79: 3028-3037, 2005. IF = 5.178 *E-mail: parruda@unicamp.br
P198-05 SsNAC23, a member of the NAC domain protein family, is associated with cold, herbivory and water stress in sugarcane Nogueira FTS, Schlogl PS, Camargo SR, Fernandez JH, Rosa VE, Pompermayer P, Arruda P* Plant Science 169: 93-106, 2005. IF = 1.605 *E-mail: parruda@unicamp.br
P199-05 Endosperm-preferred expression of maize genes as revealed by transcriptome-wide analysis of expressed sequence tags Verza NC, Silva TRE, Neto GC, Nogueira FTS, Fisch PH, Rosa VE, Rebello MM< Vettore AL, Silva FR, Arruda P* Plant Molecular Biology 59: 363-374, 2005. IF = 3.328 *E-mail: parruda@unicamp.br
P200-05 Genomic structure and regulation of mitochondrial uncoupling protein genes in mammals and plants Nogueira FTS, Borecky J, Vercesi AE, Arruda P* Bioscience Reports 25: 209-226, 2005. IF = 0.489 *E-mail: parruda@unicamp.br
P201-05 Renal and antibacterial effects induced by myotoxin I and II isolated from Bothrops jararacussu venom Barbosa PSF, Martins AMC, Havt A, Toyama DO, Evangelista JSAM, Ferreira DPP, Joazeiro PP*, Beriam LOS, Toyama MH, Fonteles MC, Monteiro HAS Toxicon 46: 476-486, 2005. IF = 2.255 *E-mail: pjoaz@unicamp.br
P202-05 Ultratsructural, immunohistochemical and biochemical analysis of glycosaminoglycans and proteoglycans in the mouse, pubic symphysis during pregnancy Pinheiro MC, Mora OA, Caldini EG, Battlehner CN, Joazeiro PP*, Toledo OMS Cell Biology International 29: 458-471, 2005. IF = 1.194 *E-mail: pjoaz@unicamp.br
P203-05 Does orchidopexy revert the histological alterations in epididymal and vas deferens caused by cryptorchidism? Arroteia KF, Joazeiro PP, Pereira LAV* Archives of Andrology 51: 109-119, 2005. IF = 0.609 *E-mail: lviolin@unicamp.br
P204-05 Protamine-induced epithelial barrier disruption involves rearrangement of cytoskeleton and decreased tight junction-associated protein expression in cultured MDCK strains Peixoto EBMI, Collares-Buzato CB* Cell Structure and Function 29: 165-178, 2005. IF = 3.354 *E-mail: collares@unicamp.br
P205-05 New fission processes in the zoanthid Palythoa canibaeorum: description and quantitative aspects Acosta A, Sammarco PW, Duarte LFL* Bulletin of Marine Science 76: 1-26, 2005. IF = 0.814 *E-mail: lduarte@unicamp.br
P206-05 Respostas biológicas de Anagasta kuehniella e de seu parasitóide, Bracon hebetor à radiação por microondas (2450 MHz) Fagundes GG, Habib MEEM*, Solis DR Revista de Agricultura 80: 12-34, 2005. *E-mail: habib@unicamp.br
P207-05 Patogenicidade de nematóides enteropatogênicos a ovos e larvas de Migdolus fryanus (Westwood, 1863)(Coleoptera: Vesperidae) Machado LA, Habib MEEM*, Leite LG, Calegari LC, Goulart RM, Tavares FM Arquivos do Instituto Biológico 72: 221-226, 2005. *E-mail: habib@unicamp.br
P208-05 ISER: selection of differentially expressed genes from DNA array data by non-linear data transformation and local fitting Drummond RD, Pinheiro A, Rocha CS, Menossi M* Bioinformatics 21: 4427-4429, 2005. IF = 6.019 *E-mail: menossi@unicamp.br
P209-05 Transcriptionally active transposable elements in recent hybrid sugarcane Araújo PG, + 10 authors, Menossi M*, van Sluys MA The Plant Journal 44: 701-717, 2005. IF = 6.969 *E-mail: menossi@unicamp.br
P210-05 Effect of anion channel antagonists and La3+ on citrate release, Al content and Al resistance in maize roots Jorge RA, Menossi M* Journal of Inorganic Biochemistry 99: 2039-2045, 2005. IF = 2.423 *E-mail: menossi@unicamp.br
P211-05 Glutathione S-transferase and aluminium toxicity in maize Cancado GMA, Rosa VE, Fernadez JH, Maron LG, Jorge RA, Menossi M* Functional Plant Biology 32: 1045-1055, 2005. IF = 2.496 *E-mail: menossi@unicamp.br
P212-05 Isolation and characterization of Coffea genes induced during coffee leaf miner (Leucoptera coffeella) infestation Mondego JMC, Guerreiro-Filho O, Bengtson MH, Drummond RD, Felix JM, Duarte MP, Ramiro D, Maluf MP, Sogayar MC, Menossi M* Plant Science 169: 351-360, 2005. IF = 1.605 *E-mail: menossi@unicamp.br
P213-05 Transcription profiling of signal transduction-related genes in sugarcane tissues Papini-Terzi FS + 11 authors, Menossi M*, Souza GM DNA Research 12: 27-38, 2005. IF = 3.896 *E-mail: menossi@unicamp.br
P214-05 Perspectives on bioenergy and biotechnology in Brazil Pessoa Jr A, Roberto IC, Menossi M*, dos Santos RR, Ortega S, Penna TCV Applied Biochemistry and Biotechnology 121: 59-70, 2005. IF = 0.805 *E-mail: menossi@unicamp.br
P215-05 Phenotypic plasticity of the aedeagus of Drosophila mediopunctata: effect of the temperature Andrade CAC, Hatadani LM, Klaczko LB* Journal of Thermal Biology 30: 518-523, 2005. IF = 0.871 *E-mail: lbk@unicamp.br
P216-05 Male-killing Spiroplasma naturally infecting Drosophila melanogaster Montenegro H, Solferini VN, Klaczko LB*, Hurst GDD Insect Molecular Biology 14: 281- , 2005. IF = 2.390 *E-mail: lbk@unicamp.br
P217-05 Analysis of mitochondrial DNA variability and genetic structure in populations of new world screwworm flies (Diptera: Calliphoridae) from Uruguay Lyra ML, Fresia P, Gama S, Klazko LB*, Azeredo-Espin AML Journal of Medical Entomology 42: 589-595, 2005. IF = 1.489 *E-mail: lbk@unicamp.br
P218-05 Some socioeconomic aspects related to intestinal parasitosis and evaluation of an educational intervention in scholars from Estiva Gerbi, SP Ferreira GR, Andrade CFS* Revista da Sociedade Brasileira de Medicina Tropical 38: 402-405, 2005. *E-mail: cfandra@unicamp.br
P219-05 Biotic interactions of mites, plants and leaf domatia Romero GQ, Benson WW* Current Opinion in Plant Biology 8: 436-440, 2005. IF = 10.807 *E-mail: wbenson@unicamp.br
P220-05 Cytokines and intrathecal IgG synthesis in multiple sclerosis patients during clinical remission Brandão CO, Ruocco HH, Farias AS, Oliveira C, Hallal-Longo DEM, Mirandola SR, Oliveira EC, Cendes F, Damasceno BP, Santos LM* Arquivos de Neuro-Psiquiatria 63: 914-919, 2005. IF = 0.430 *E-mail: leonilda@unicamp.br
P221-05 Abnormal production of transforming growth factor and interferon by peripheral blood cells of patients with multidrug-resistant pulmonary tuberculosis in Brazil Castro AZ, Diaz-Bardalez BM, Oliveira EC, Garcia RC, Afiune JB, Paschoal IA, Santos LMB* Journal of Infection 51: 318-324, 2005. IF = 1.882 *E-mail: leonilda@unicamp.br
P222-05 Granulocyte-macrophage colony-stimulating factors does not increase the potency or efficacy of a foot-and-mouth disease virus subunit vaccine Caron L, Brum MCS, Moraes EP, Golde WI, Arns CW*, Grubman MJ Pesquisa Veterinária Brasileira 25: 150-158, 2005. IF = 0.239 *E-mail: arns@unicamp.br
P223-05 Detection of Brazilian bovine respiratory syncytial vírus strain by a reverse transcriptase-nested-polymerase chain reaction in experimentally infected calves Almeida RS, Spilki FR, Roehe PM, Arns CW* Veterinary Microbiology 105: 131-135. IF = 2.175 *E-mail: arns@unicamp.br
P224-05 Subtyping of new Brazilian avian metapneumovirus isolates from chickens and turkeys by reverse transcriptase-nested-polymerase chain reaction D’Arce RCF, Coswig LT, Almeida RS, Trevisol IM, Monteiro MCB, Rossini LI, Di Fabio J, Hafez HM, Arns CW* Avian Pathology 34: 133-136, 2005. IF = 1.789 *E-mail: arns@unicamp.br
P225-05 Uncaria tomentosa extract increases the number of myeloid progenitor cells in the bone marrow of mice infected with Listeria monocytogenes Eberlin S, Queiros MLS, Santos LMB* Immunopharmacology 5: 1235-1246, 2005. *E-mail: leonilda@unicamp.br
P226-05 Fisiologia dos adrenoceptores cardíacos Areas MA*, Pinto WJ, Cardoso SMG Revista de Ciências médicas 14: 79-99, 2005. *E-mail: migarare@unicamp.br
P227-05 Large-scale transcriptome analyses reveal new genetic marker candidates of head, neck, and thyroid cancer Reis EM + 14 authors, Pereira GAG* + 6 authors + Head and Neck Annotation Consortium Cancer Research 65: 1693-1699, 2005. IF = 7.616 *E-mail: goncalo@unicamp.br
P228-05 Focal adhesion kinase mediates MEF2 and c-Jun activation by stretch: role in the activation of the cardiac hypertrophic genetic program Nadruz Jr W, Corat MAF, Marin TM, Pereira GAG*, Franchini KG Cardiovascular Research 68: 87-97, 2005. IF = 5.283 *E-mail: goncalo@unicamp.br
P229-05 Control of Saccharomyces cerevisiae flocculation by sugar for industrial ethanol production Cunha AF, Missawa SK, Reis SF, Pereira GAG* FEMS Yeast Research 6: 280-287, 2005. IF = 2.477 *E-mail: goncalo@unicamp.br
P230-05 How many species are there in Brazil? Lewinsohn TM*, Prado PI Conservation Biology 19: 619-624, 2005. IF = 4.110 *E-mail: thomas@unicamp.br
P231-05 Flower-heads, herbivores and their parasitoids: food web structure along a fertility gradient Fonseca CR, Prado PI Almeida Neto M, Kubota U, Lewinsohn TM* Ecological Entomology 30: 36-46, 2005. IF = 1.808 *E-mail: thomas@unicamp.br
P232-05 Insects on plants: diversity of herbivore assemblages revisited Lewinsohn TM*, Novotny V, Basset Y Annual Review of Ecology, Evolution and Systematics 30: 36-46, 2005. IF = 10.104 *E-mail: thomas@unicamp.br
P233-05 Diversidade e ocorrência de Asteraceae em cerrados de São Paulo Almeida AM, ..., Lewinsohn TM* Biota neotropica 5: 1-15, 2005. *E-mail: thomas@unicamp.br
P234-05 Occurrence of F42 colonization factor in Escherichia coli strains isolated from piglets with diarrhea Penatti MPA, Silva AS, Valadares GF, Leite DS* Pesquisa Veterinária Brasileira 25: 31-35, 2005. IF = 0.175 *E-mail: domingos@unicamp.br
|
|
Diretoria do Instituto de
Biologia |
Fone: (19)
37886358 / 37886361 |
02
E-mail:
msvgatti@unicamp.br,